KEGG   Bacillus subtilis subsp. subtilis 168: BSU07020
Entry
BSU07020          CDS       T00010                                 

Symbol
rhgT
Name
(RefSeq) rhamnogalacturonan acetylesterase RhgT
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: Lipase_GDSL_2 Lipase_GDSL DnaB_C
Other DBs
NCBI-GeneID: 936074
NCBI-ProteinID: NP_388583
Pasteur: BG12854
BSORF: BG12854
UniProt: O31523 A0A6M3Z8C9
Position
768137..768835
AA seq 232 aa
MMKKPIQVFLAGDSTVSDCPPHEAPMAGWGQVFGQLFSEGVLVRNHAKGGASTNSFVEEG
RLQAIAEHITQGDYLLIQFGHNDQKPRGTKPYSTFQQFLTLFADTAREKGAHPVFVTSVQ
RRRFDENGRIEHTLGEYPDAMKALAKELDVPVIDLLAKTKVLYEAYGPEESKRLFVWFQP
NEHPNYPDGIEDNTHFSEKGAMEVAKLVAEGIEELGLPLKDHLVSREGKEHV
NT seq 699 nt   +upstreamnt  +downstreamnt
gtgatgaagaaaccgattcaagtatttttagcgggggattccactgtgagtgactgcccg
cctcatgaagcgccgatggcggggtgggggcaggtattcgggcaattgttttctgaaggt
gtgctggtccgcaatcatgccaaaggaggagcgagcaccaattcttttgtggaggaagga
aggcttcaagcaattgccgagcacatcacacaaggcgattatttgttgattcaattcggc
cacaatgaccaaaaaccgcgggggacgaagccgtactccacatttcagcagtttcttacc
ttgtttgcagatacggcacgcgaaaagggcgcgcatcctgtgttcgtcacatcggtgcag
cgccgccgctttgatgaaaacggacggatcgagcatacgctcggtgagtatcccgatgcg
atgaaagcactggcgaaggagctcgatgtacctgtgattgatctgcttgcgaaaacaaag
gtgctgtatgaagcatacgggccggaggagtcgaagcgattgttcgtttggtttcagccg
aatgaacatccgaattacccggacggcattgaggacaatacgcatttttcggaaaaaggt
gcaatggaggttgcgaagcttgtggcagaaggcattgaagagctcggacttccgcttaag
gaccaccttgtgagccgggagggaaaagaacatgtataa

DBGET integrated database retrieval system