KEGG   Bacillus subtilis subsp. subtilis 168: BSU07030
Entry
BSU07030          CDS       T00010                                 

Gene name
yesU
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: DUF1961
Other DBs
NCBI-GeneID: 936083
NCBI-ProteinID: NP_388584
Pasteur: BG12855
BSORF: BG12855
UniProt: O31524
Structure
PDB: 
1OQ1

Position
768828..769490
AA seq 220 aa
MYKEGACLYRNPLRSKSDVKDWRMEGGGQISFDDHSLHLSHVQDEAHFVFWCPETFPDGI
IVTWDFSPIEQPGLCMLFFAAAGIRGEDLFDPSLRKRTGTYPEYHSGDINALHLSYFRRK
YAEERAFRTCNLRKSRGFHLAAMGADPLPSPDDADSPYRMKLIKDKGYVHFSINGLPILE
WMDDGSTYGPVLTKGKIGFRQMAPMKAVYRDFAVHQAVRR
NT seq 663 nt   +upstreamnt  +downstreamnt
atgtataaggaaggcgcttgcttgtaccgcaatccgctccggtctaaaagcgatgtgaag
gattggcggatggagggaggcggacagatctcatttgacgatcacagcttgcacctgtca
catgtccaggatgaagcgcactttgtcttttggtgtccggaaacctttccagacggcatc
attgtgacatgggacttctctccgatcgagcagcctggactgtgtatgctgttttttgcc
gctgcgggtattcgcggcgaggatttgtttgacccaagtctcaggaaaagaacaggaaca
taccctgagtatcattcaggagatatcaatgccctccacctgtcgtatttccgcagaaaa
tacgcggaggaaagagcgttccgcacctgcaatttaagaaaaagccgcggtttccatctc
gccgcaatgggggccgatccgctgccttctccagacgacgctgattctccgtatcgtatg
aagctgatcaaagacaaaggctatgtgcacttttcaatcaatggtctgcccattcttgag
tggatggacgacggcagcacatatgggcctgtgttaacaaaaggaaaaatcgggttccgg
cagatggcccccatgaaagccgtttacagggattttgccgtgcatcaagcggtgagaaga
tga

DBGET integrated database retrieval system