KEGG   Bacillus subtilis subsp. subtilis 168: BSU07040
Entry
BSU07040          CDS       T00010                                 

Symbol
yesV
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: DUF624
Other DBs
NCBI-GeneID: 936077
NCBI-ProteinID: NP_388585
Pasteur: BG12856
BSORF: BG12856
UniProt: O31525 A0A6M3ZBJ7
Position
769487..770113
AA seq 208 aa
MKTTVTDALYAGCEAVVKIAWLNGLWLLFTLLGGVLFGWAPSTAAMCAVIRKWLMGQKDV
PIFSLFLDTYKKEFLKVNAIGLAFSALLLILSANYHYFSASTNWLSFAVTSCTLLAGLLY
IIALMYVFPLYVHYQLPLRKYIPQALLFGAMRPLTTGCMLIGCGFVLYLLYTLPGLIPFY
GPCLFGLVLMFFALRGFQKTEAQHHQAG
NT seq 627 nt   +upstreamnt  +downstreamnt
atgaagacgactgtaacggatgcgctttatgcaggctgcgaagcggtggtgaaaatagca
tggctcaacgggctgtggctgttgtttacacttttgggcggcgttcttttcggatgggcg
ccgagcacagctgcgatgtgtgccgttataaggaaatggctgatggggcaaaaggatgtc
ccgatattttcgttatttctcgatacctataaaaaagagtttctcaaggttaatgcgatc
ggattggcgttttcggctcttttgctcatattgtctgccaactatcattatttttctgcc
agtacgaattggctgtcctttgccgtaacaagctgcacgctgcttgcagggcttttgtat
atcatcgcgctgatgtatgtgtttcccctttatgtgcattaccagctcccgcttcgcaaa
tatattccgcaggcactgctgtttggcgccatgagaccgctgacaactggctgtatgctg
atcgggtgcggatttgtcctttatttgctgtatacgcttcctggcctgatcccattttac
ggcccgtgtttatttgggcttgtgttgatgttttttgctcttaggggatttcaaaagacg
gaggcccagcaccatcaagccgggtaa

DBGET integrated database retrieval system