KEGG   Bacillus subtilis subsp. subtilis 168: BSU07050Help
Entry
BSU07050          CDS       T00010                                 

Gene name
yesW
Definition
(RefSeq) rhamnogalacturonan endolyase YesW
  KO
K18197  rhamnogalacturonan endolyase [EC:4.2.2.23]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BSU07050 (yesW)
Enzymes [BR:bsu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.2  Acting on polysaccharides
    4.2.2.23  rhamnogalacturonan endolyase
     BSU07050 (yesW)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RGI_lyase VCBS FG-GAP DUF4249
Motif
Other DBs
NCBI-GeneID: 938769
NCBI-ProteinID: NP_388586
Pasteur: BG12857
BSORF: BG12857
UniProt: O31526
Structure
PDB: 

Position
770234..772096
Genome map
AA seq 620 aa AA seqDB search
MRRSCLMIRRRKRMFTAVTLLVLLVMGTSVCPVKAEGAARQMEALNRGLVAVKTDGGIFV
SWRFLGTENASVLFNVYRDGQKLNAAPVKTTNYVDKNGSAGSTYTVRAVVNGTEQPASEK
ASVWAQPYHSVPLDKPAGGTTPKGESYTYSANDASVGDVDGDGQYELILKWDPSNSKDNS
QDGYTGDVLIDAYKLDGTKLWRINLGKNIRAGAHYTQFMVYDLDGDGKAEVAMKTADGTK
DGTGKVIGNANADYRNEQGRVLSGPEYLTVFQGSTGKELVTANFEPARGNVSDWGDSYGN
RVDRFLAGIAYLDGQRPSLIMTRGYYAKTMLVAYNFRDGKLSKLWTLDSSKSGNEAFAGQ
GNHNLSIADVDGDGKDEIIFGSMAVDHDGKGMYSTGLGHGDALHTGDLDPGRPGLEVFQV
HEDKNAKYGLSFRDAATGKILWGVYAGKDVGRGMAADIDPRYPGQEVWANGSLYSAKGVK
IGSGVPSSTNFGIWWDGDLLREQLDSNRIDKWDYQNGVSKNMLTASGAAANNGTKATPTL
QADLLGDWREEVVWRTEDSSALRIYTTTIPTEHRLYTLMHDPVYRLGIAWQNIAYNQPPH
TSFFLGDGMAEQPKPNMYTP
NT seq 1863 nt NT seq  +upstreamnt  +downstreamnt
atgagaaggagctgtctgatgattagacgaaggaaacgcatgtttaccgctgttacgttg
ctggtcttgttggtgatgggaacctctgtatgtcctgtgaaagctgaaggggcagcgcgg
cagatggaagcgctgaaccgggggcttgtagcggtcaagacggacgggggcatttttgtc
agctggcggtttcttggaaccgaaaacgcatctgttttgttcaatgtgtacagagacggg
caaaaactgaatgctgcgcctgtcaaaacaacgaactatgtggataaaaacggttcggcg
ggctcaacgtatacggttcgggctgttgtaaacggtaccgaacagccggcttctgaaaaa
gcctccgtatgggcgcagccgtatcattccgtcccgctggataaaccggctggcggcacg
acgccaaagggtgaatcttacacgtacagcgctaatgacgcaagtgttggcgatgtggat
ggtgacgggcaatacgagctgatcctgaaatgggacccgtccaactcaaaagacaattca
caggatggctatacgggtgacgtgctgattgacgcgtataaactggacggcacaaagtta
tggcggatcaatctcggcaaaaacatcagagcgggcgcgcactacacccagtttatggtg
tatgaccttgatggtgacggaaaagcagaagtggcaatgaaaacggcagacgggacaaaa
gacggcacgggcaaagtaattggaaatgccaatgcagattacagaaatgaacaggggcgt
gtgctttcaggccctgaatatctcactgtgtttcaaggttcaaccgggaaagagcttgtc
accgcaaattttgaaccggcgcgcggcaatgtgtcggattggggagacagctacggcaac
cgtgttgaccgttttctcgccggcattgcctaccttgatggacagcggccgagcctgatc
atgaccagagggtattacgctaaaaccatgctagttgcctataacttcagggacggaaag
ctgtcaaagctttggacgctggactcctcaaagtcaggaaatgaagcgtttgccggacag
gggaatcacaacctgagcatcgcggacgttgacggggatggaaaagatgagattattttc
ggctcaatggctgttgatcatgacgggaaaggcatgtactcgaccggcttaggccatggg
gatgccctccatacaggagatcttgatccgggccggccggggcttgaggtgtttcaagtt
catgaggacaaaaatgcaaaatacggcttatctttccgggatgctgcaactggaaaaatc
ctttggggcgtttatgccggcaaggatgtaggccggggaatggctgctgatattgacccg
cgttatccgggacaggaggtgtgggcaaacggttctctctactcagcgaaaggggtcaaa
atcggaagcggggttccgtcctcgaccaacttcggcatctggtgggacggcgatctgctc
cgggaacagctggacagcaaccgaattgataagtgggattatcaaaacggcgtatcgaaa
aatatgctgactgcatcaggcgcagcggctaacaacggcacaaaagcaacaccaacgctt
caggctgatctgctcggtgactggcgcgaggaagtggtgtggagaacggaggacagcagt
gctctgcgcatttacacgacgaccattccgactgagcacaggctgtatacgctgatgcac
gatccggtgtaccggcttggcatcgcctggcaaaatatcgcctataaccagccgccgcac
acaagcttctttttaggagacggcatggcggaacagccaaaaccaaatatgtatacgcct
taa

DBGET integrated database retrieval system