KEGG   Bacillus subtilis subsp. subtilis 168: BSU07060
Entry
BSU07060          CDS       T00010                                 

Symbol
yesX
Name
(RefSeq) rhamnogalacturonan exolyase YesX
  KO
K18198  rhamnogalacturonan exolyase [EC:4.2.2.24]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BSU07060 (yesX)
Enzymes [BR:bsu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.2  Acting on polysaccharides
    4.2.2.24  rhamnogalacturonan exolyase
     BSU07060 (yesX)
SSDB
Motif
Pfam: RGI_lyase FG-GAP FG-GAP_3
Other DBs
NCBI-GeneID: 936081
NCBI-ProteinID: NP_388587
Pasteur: BG12858
BSORF: BG12858
UniProt: O31527 A0A6M4JFS4
Structure
PDB: 
2ZUY

Position
772142..773980
AA seq 612 aa
MKPKKRQMEYLTRGLIAVQTEQGVFVSWRFLGTDHETTAFHLYRDGKRITRDPIAESTNF
LDQNGTADSVYQVAAVNKGREEKLSKKARVWQENVLEVPLAKPEGGVTPDGKPYTYSAND
ASVGDIDGDGEYEMILKWDPSNSKDNAHDGYTGEVLIDAYKLDGTFLWRINLGRNIRAGA
HYTQFMVYDLDGDGKAEIAMKTADGTTDGKGHIIGDEQADFRNEQGRILSGPEYLTVFKG
ETGEALTTVEYEPPRGKLEDWGDGYGNRMDRFLAGTAYLDGERPSLVMARGYYTRTVLVA
YDFRNGRLKKRWVFDSNQPGHEAYAGQGNHSLSVADVDGDGKDEIIYGAMAVDHDGTGLY
STGLGHGDAMHVGDLDPSRKGLEVFQVHEDATKPYGLSLRDAGTGEILWGVHAGTDVGRG
MAAHIDPSYKGSLVWGIDPPGNDGMSYGLFTSKGEKISDKAPSSANFAIWWDGDLVRELL
DHDWDGTIGRPKIEKWDAENGCLKTIFQPAGVLSNNGTKGNPVLQANLFGDWREEVIWRT
EDSSALRIYTTTHLTRHCFYTLMHDPVYRLGIAWQNTAYNQPPHTSFYLGTGMKKPPKPA
LYIAGSKAEAPL
NT seq 1839 nt   +upstreamnt  +downstreamnt
atgaaaccaaaaaagaggcaaatggaatacctgaccagaggtttgattgcggtacagaca
gaacagggcgtgtttgtcagctggcgttttctcggcacggatcatgagacgacggctttt
cacctttatcgggatggaaagcggatcacccgcgatccaatcgctgaaagcactaatttt
ctcgatcaaaacggaacggctgactctgtttatcaagtggcggctgtcaataaaggacgg
gaagaaaagctttccaagaaagctcgtgtttggcaggaaaatgtcctggaggttcctctt
gccaaaccggaaggcggtgtgacgccggacggaaagccgtacacttacagcgccaatgat
gccagtgtcggggatatagacggggatggagaatatgaaatgatcctgaagtgggacccg
tccaattcaaaagacaacgctcatgacggttataccggggaggtgctcatagatgcctat
aaactggacggcacctttttgtggcgcatcaacctcggcagaaacatcagagcgggtgct
cattacacgcaatttatggtgtatgaccttgacggtgacggaaaagcagaaatcgccatg
aaaacagctgacggcacaacagacgggaaaggacatatcatcggtgatgagcaggccgat
tttagaaacgaacagggcagaattttgtccggtccggaatatttgaccgtgtttaaagga
gaaaccggtgaggcgctcacgaccgtggaatatgaaccgccccgcggcaagctggaggat
tggggagacggctatggaaaccggatggaccgttttctcgccgggaccgcttatttggat
ggggagcggccgagccttgttatggcgcgcggctactatacgagaaccgtgctcgtggca
tacgatttcagaaacggaaggctcaaaaaacgatgggtatttgactccaaccagccggga
catgaagcatacgcaggacaggggaaccacagcttgagcgtggcggacgtcgacggagac
ggaaaggatgaaatcatatacggcgcaatggctgtcgatcatgacggaaccggcctgtac
tcaacgggcctcgggcacggagacgcgatgcatgtaggggatctggacccgtcacgaaaa
gggcttgaagtgttccaggtgcatgaggacgccacgaagccgtacggactgtcgctgcga
gatgccggaaccggtgagatattatggggcgtccatgctggaactgacgttggccggggc
atggcggctcatattgatccaagctacaaaggatcgctcgtctggggaattgatccgccg
ggcaatgatggcatgtcgtacgggcttttcacgagcaaaggcgaaaaaatcagcgacaaa
gcgccctcttcagccaatttcgccatctggtgggacggtgatttggtcagagaactgctt
gatcatgactgggacggaacgatcggcaggccaaagattgaaaaatgggatgctgaaaac
ggctgtctgaagacgatatttcagccggccggcgtgttgtccaacaacggcacgaaagga
aacccggttcttcaggccaacctgttcggagactggcgggaagaagtgatatggagaacg
gaagacagcagcgcgctccgtatctatacaacaacacatctcacccgccactgcttttac
acgctgatgcatgatccggtttacaggctcggcatcgcctggcagaataccgcctacaac
cagccgccgcacacgagcttttacctcggaacgggaatgaaaaaaccgccgaagcccgcc
ctgtacatagcgggaagcaaagcggaggcgccgctgtag

DBGET integrated database retrieval system