KEGG   Bacillus subtilis subsp. subtilis 168: BSU07070Help
Entry
BSU07070          CDS       T00010                                 

Gene name
yesY
Definition
(RefSeq) rhamnogalacturonan acetylesterase YesY
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Lipase_GDSL_2 Lipase_GDSL Methyltransf_1N MCD
Motif
Other DBs
NCBI-GeneID: 938772
NCBI-ProteinID: NP_388588
Pasteur: BG12859
BSORF: BG12859
UniProt: O31528
Position
774138..774791
Genome map
AA seq 217 aa AA seqDB search
MANHIYLAGDSTVQTYGDSTNQGGWGQFLGSHLPEHIQVINRAIGGRSSKTFVEEGRLQA
ILDVIEPDDWLFVQMGHNDASKNKPERYTEPYTTYKQYLKQYIAGAREKGAHPLLITPVA
RFHYENGVFLNDFPDYCIAMKQTAAEENVQLIDLMEKSLAFFTEKGEEKVYTYFMISEGI
NDYTHFTKKGANEMAKLVAKGIKELGLPLTESIIKER
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
atggcaaatcatatttatcttgccggcgattcgactgttcaaacgtatggagacagcaca
aatcaagggggctgggggcagtttctcggctcgcatctgccggagcatattcaagtgatc
aacagagcgatcgggggaagaagctcgaaaacatttgtggaagagggcaggcttcaggca
atcctcgatgtgattgagccggatgattggctgttcgtgcagatgggccataatgacgcg
tcaaaaaataagccggagcgctacaccgagccctatactacttataaacaatatttaaag
cagtatatcgcaggcgcgcgggaaaaaggcgcccatccgcttctcattacccccgtagcc
cgctttcattacgaaaacggcgtgtttttgaacgattttcctgattactgcattgccatg
aagcagacggccgctgaggagaatgtccagctcattgatctgatggagaaaagtctcgct
ttctttactgagaagggcgaggaaaaagtgtacacctattttatgatttcagaagggatt
aacgattacacgcattttacaaaaaaaggcgcaaatgaaatggcgaaacttgtggcaaaa
ggcataaaggagctcggcctgccattgacagaatcgatcatcaaagaaaggtga

DBGET integrated database retrieval system