KEGG   Bacillus subtilis subsp. subtilis 168: BSU07070
Entry
BSU07070          CDS       T00010                                 

Symbol
yesY
Name
(RefSeq) rhamnogalacturonan acetylesterase YesY
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: Lipase_GDSL Lipase_GDSL_2 Methyltransf_1N
Other DBs
NCBI-GeneID: 938772
NCBI-ProteinID: NP_388588
Pasteur: BG12859
BSORF: BG12859
UniProt: O31528 A0A6M3Z8U9
Position
774138..774791
AA seq 217 aa
MANHIYLAGDSTVQTYGDSTNQGGWGQFLGSHLPEHIQVINRAIGGRSSKTFVEEGRLQA
ILDVIEPDDWLFVQMGHNDASKNKPERYTEPYTTYKQYLKQYIAGAREKGAHPLLITPVA
RFHYENGVFLNDFPDYCIAMKQTAAEENVQLIDLMEKSLAFFTEKGEEKVYTYFMISEGI
NDYTHFTKKGANEMAKLVAKGIKELGLPLTESIIKER
NT seq 654 nt   +upstreamnt  +downstreamnt
atggcaaatcatatttatcttgccggcgattcgactgttcaaacgtatggagacagcaca
aatcaagggggctgggggcagtttctcggctcgcatctgccggagcatattcaagtgatc
aacagagcgatcgggggaagaagctcgaaaacatttgtggaagagggcaggcttcaggca
atcctcgatgtgattgagccggatgattggctgttcgtgcagatgggccataatgacgcg
tcaaaaaataagccggagcgctacaccgagccctatactacttataaacaatatttaaag
cagtatatcgcaggcgcgcgggaaaaaggcgcccatccgcttctcattacccccgtagcc
cgctttcattacgaaaacggcgtgtttttgaacgattttcctgattactgcattgccatg
aagcagacggccgctgaggagaatgtccagctcattgatctgatggagaaaagtctcgct
ttctttactgagaagggcgaggaaaaagtgtacacctattttatgatttcagaagggatt
aacgattacacgcattttacaaaaaaaggcgcaaatgaaatggcgaaacttgtggcaaaa
ggcataaaggagctcggcctgccattgacagaatcgatcatcaaagaaaggtga

DBGET integrated database retrieval system