KEGG   Bacillus subtilis subsp. subtilis 168: BSU07090
Entry
BSU07090          CDS       T00010                                 

Symbol
yetA
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: YetA
Other DBs
NCBI-GeneID: 938776
NCBI-ProteinID: NP_388590
Pasteur: BG12861
BSORF: BG12861
UniProt: O31530 A0A6M4JFW5
Position
776834..779407
AA seq 857 aa
MKKIKWLSGQPKVTSGVTWGMPWKKGELKKGDRLALMNENAETRYVQSEPSAYWPDGSIK
WTKHAAVFGGQENQSFTVHKREVPQPTESLSILETEHDIQVDTGALVCTIHKTGSDFIQS
LQINGKPIAAGGRLVAIRETRKESAAKMVLLHERSVSFIKRAAIEQSGPVKAVVKIEGVH
VLHKTYEEWLPFVIRLTFYAGLSEIGLVHTQLIDRSGKLEFVKGLGIEFDLFLEGEPYNR
HFRFAGEKGMYKEPAQLFGTRKFNERYPLYEKQINGEMLSPDEEHKEWFAHGTQNAVWDD
VKIVQDSSDHYSLSKRTGKDYAWVGMLHGSRAKGLCYAGGKNGGVALGLRYFFEKYPSAL
EITGLAGSRPKMTIWLWPPDGEAMDLRHYTGNTHVASAYEGFDEMRSDPTGIANTNEISL
ACFSHMPSDEVLNALADKWQAPPLIVCEPDVYYESKALGVWSIIDTSHPLKKELEEQLDA
AFLFYKKEVEQRRWYGFWHYGDVMHTYDPIRHMWRYDLGGYAWQNNELVPTLWLWQAFFR
SGREDIFRMAEAMTRHTSETDSFHLGEYAGLGSRHNVVHWGCGCKEARISMAGLHKFYYY
LTGDDRTGDLLTEVKDADYALVKTDPMRAFYEKGKHPTHARTGPDWAAFCSNWLAEWERT
ENSEYLKKIETGINCLKRLPLRLLSGPTFEYDPATSMLHHMGDGIAGGYHMIIAFGAPQV
WMELAELLDDWEWEDMLSEFGEFYTLSDEEKRKKSGGALHDGHFHWPMFAAGMTAYAARK
KQDPHLAAKAWNLLLEDKLSHTPLPIKPERIETWTQLEELPWVTTNTVSQWCLNVIAALE
LIGDSLPAKKETSGKKG
NT seq 2574 nt   +upstreamnt  +downstreamnt
atgaaaaagatcaaatggttatcaggacagccaaaggtgacaagcggcgtgacgtggggc
atgccatggaaaaaaggagaattaaaaaaaggagaccgtctggcgcttatgaatgaaaac
gcggaaacgcgatatgtgcaaagcgaaccgtcggcctattggccggacgggagcatcaag
tggacgaagcacgcggcggtgtttggcggtcaggaaaaccaaagctttacagtgcacaaa
agagaagtgccgcagccaactgaatcgctcagcattcttgagacagagcatgatatccaa
gtggatacaggagcactcgtttgtaccattcataaaacaggatctgatttcattcaatca
ttgcagatcaatggaaagccgatcgccgcaggcgggaggctcgttgcgataagagaaacg
agaaaagagtcagcggcgaaaatggttcttttgcatgaaaggtctgtcagctttatcaaa
cgggcggcgattgagcagagtggtcctgtcaaagcagtagtcaaaatcgagggagtgcat
gtgcttcataaaacgtatgaggaatggctgccgtttgtcatccgattaacgttttatgcc
gggctgtctgagatcggccttgtgcacacgcagctgattgacaggagcggtaaactagaa
ttcgttaaggggctcggcatcgaattcgacctttttttggagggagagccgtacaaccgc
catttccgctttgcgggagagaaagggatgtataaagaacccgcccagctgtttggcaca
cgtaaattcaatgaacgatatccgctttatgaaaaacaaatcaatggcgaaatgctgtct
ccagatgaagagcataaggaatggtttgcacatggcacacagaatgcggtttgggacgat
gtcaagatcgtgcaagattccagcgatcattacagcctgtcaaaacggaccggaaaagat
tatgcgtgggttggaatgctgcatggcagccgggcgaaggggctctgctatgcgggcgga
aaaaatggcggtgtggctctcggcctgcggtatttctttgagaaatatccttcagcactg
gaaatcacaggtcttgccggcagccgccccaaaatgactatctggctttggcctccggac
ggcgaagcgatggatttgcggcattatacaggaaacactcacgtggccagcgcgtatgaa
ggctttgatgaaatgcgctctgatccgacaggcattgcgaacacaaatgaaataagcctg
gcgtgcttttcgcacatgccgtctgacgaagtcctcaatgcgctggctgacaaatggcag
gcgcccccgctcattgtatgcgagccggacgtctattacgaatcaaaagcactcggggta
tggagcatcattgacacatcccatccgctcaaaaaagagctggaagaacagcttgatgcg
gcctttctgttttataaaaaggaagtagagcaacgcagatggtacggtttttggcattat
ggcgatgtcatgcatacgtatgacccgatccggcatatgtggcggtacgatctcggcgga
tacgcatggcaaaacaatgagctcgttccgaccctatggctgtggcaggcgtttttccgc
tcaggcagagaggatatcttccgaatggcagaagccatgacccgccatacgagtgaaacg
gacagctttcacctcggtgaatatgccgggcttggctcacggcataatgttgtgcactgg
ggatgcggctgcaaggaagcgagaatcagcatggccgggcttcataaattctattattat
ctgacgggtgatgaccggacgggagatcttttgacagaagtgaaggatgccgattatgcc
cttgtcaaaaccgatccgatgcgcgctttttacgagaaaggcaagcacccgactcacgcc
agaacgggaccggactgggcggcgttttgctcgaactggctggcggaatgggagcggacc
gaaaattcggaatatctcaaaaaaatcgaaacgggaatcaactgtctgaagcggctgccg
ctccgcttattatctggcccgacatttgaatatgatccggcgacctcgatgcttcatcat
atgggagacggcattgcgggcggatatcatatgatcattgccttcggcgcgccgcaagtg
tggatggagctggctgagcttcttgatgactgggaatgggaggatatgctgagtgaattc
ggcgaattttacacactcagtgatgaggaaaaacgaaaaaaaagcggaggcgctcttcat
gacgggcattttcactggccgatgttcgccgccggtatgacagcctacgccgcaagaaaa
aagcaagatcctcatctcgccgccaaagcgtggaatcttttgctagaagataagctcagc
catacgccgcttccgatcaaaccggagcgcatcgagacatggacgcagctagaggagctt
ccatgggtgacaacgaacactgtctctcaatggtgtttaaatgtcatagcggcgctggaa
ctgatcggagattcccttccggcaaaaaaagaaacatcgggcaaaaaaggataa

DBGET integrated database retrieval system