KEGG   Bacillus subtilis subsp. subtilis 168: BSU07100
Entry
BSU07100          CDS       T00010                                 

Gene name
lplA
Definition
(RefSeq) lipoprotein
  KO
K17318  putative aldouronate transport system substrate-binding protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    BSU07100 (lplA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU07100 (lplA)
Transporters [BR:bsu02000]
 ABC transporters, prokaryotic type
  Saccharide, polyol, and lipid transporters
   Putative aldouronate transporter
    BSU07100 (lplA)
SSDB
Motif
Pfam: SBP_bac_1 SBP_bac_8 CdvA Methyltransf_33
Other DBs
NCBI-GeneID: 936079
NCBI-ProteinID: NP_388591
Pasteur: BG10434
BSORF: BG10434
UniProt: P37966 A0A6M3Z866
Position
779529..781037
AA seq 502 aa
MKIRMRKKWMALPLAAMMIAGCSHSETSNSASGSKDTIKIMAPLLSPESPSDKSPSLKAL
EKYTGKEIKVTWVPDSSYNDKFNIVMASGEMPHAIVIKDKSAGFIKSVKAGAFWELSPYL
KDYKNLSQADEKILKNSSVNGEVYGIYRTRDLIRACMIIRTDWLKNVGLDMPETLDDFYE
VLKAFKEKDPDGNGKDDTYGMVVPKWMGLGNGSPWDVLQIWFGAPNRYGVENGKLIPDFT
TKEYMDALTFFKKLYDEGLINKDFAVMDSAKWNDPVVKGKAGVIVDTGSRASQIQSAMEE
ADESNKDIIDIVGSLEGPNGKRTFPTSGYSGMITIPKSSVKTEKELKEVLSFLDKMNDKE
AQILTNNGVKGRNYELKDGVFTSLEKNNKSLLYEHEGLAQFSMSIPKSEYYIEDQKTKLF
QHRKDIITEGEKIAVFNPAESLVSDVYTQKGAQLDNIILDARTQFIIGEIDEKGFDDAVE
LWKKSGGNELMKDLNKLYQSSK
NT seq 1509 nt   +upstreamnt  +downstreamnt
atgaaaataagaatgcgaaaaaaatggatggccttgccgcttgctgccatgatgatcgcc
ggatgcagccattcggaaacatccaattcagcaagcggttcgaaagatacgatcaaaatt
atggcgccgctcttatcgccggaaagcccaagtgataagagcccttcattaaaagcgctc
gaaaaatacacaggcaaagagattaaggtcacatgggtgcctgattcatcctacaacgac
aaattcaacatcgtcatggcttcaggagagatgcctcacgcgattgtcattaaagataag
tcagccggctttatcaaatctgtcaaagcaggggcgttttgggagctgtctccttattta
aaagactacaagaatttaagccaggcagatgaaaagattttgaagaacagctcggtgaac
ggcgaggtgtacggaatctacagaacgagggatctgatcagggcgtgtatgatcatcaga
accgactggctgaaaaatgtcggtctggatatgccggaaacgcttgatgatttctatgaa
gtgctgaaagcctttaaggaaaaagatcctgacggaaacggcaaggatgatacgtacggc
atggtcgtgccgaaatggatgggactcggcaacggaagcccatgggatgttctgcaaatc
tggttcggcgctccgaaccgctacggtgttgaaaacggaaagctgattccagattttaca
acgaaggaatacatggatgcgctcacgttttttaaaaagctctatgatgagggcttgatc
aataaggactttgctgtcatggattctgcgaagtggaatgatccggttgtaaaaggaaaa
gcgggtgtcatcgttgatacaggctcaagagcgtctcaaatccaaagcgcgatggaggag
gcggatgagtcgaacaaggatatcattgatatcgtcggctcgcttgagggaccgaatggc
aagcgcaccttcccgacatctggttattcaggcatgatcacgataccaaaatcaagcgtc
aaaaccgaaaaagagctgaaagaggtgctgtccttcctcgataagatgaatgataaggaa
gcgcagattctcacgaacaacggagtgaagggccgcaattacgagctcaaggacggcgta
ttcacctcacttgaaaaaaacaataaatctctcctgtatgagcatgaaggcttggcacag
ttcagcatgtcgattccgaaaagcgagtattacatcgaagaccagaaaaccaagctcttc
cagcatcgcaaggacatcataaccgaaggagaaaaaatagccgtctttaaccctgctgag
tcgcttgtatctgatgtctatacccaaaaaggagcccagcttgacaacatcatcctcgac
gcgagaacacaatttatcattggagaaattgatgaaaaagggttcgatgatgcggtggag
ctttggaaaaaaagcggcggcaatgaactgatgaaggacttgaacaaattgtaccaatcg
tcaaaataa

DBGET integrated database retrieval system