KEGG   Bacillus subtilis subsp. subtilis 168: BSU07110
Entry
BSU07110          CDS       T00010                                 

Symbol
lplB
Name
(RefSeq) ABC transporter permease LplB
  KO
K17319  putative aldouronate transport system permease protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    BSU07110 (lplB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU07110 (lplB)
Transporters [BR:bsu02000]
 ABC transporters, prokaryotic type
  Saccharide, polyol, and lipid transporters
   Putative aldouronate transporter
    BSU07110 (lplB)
SSDB
Motif
Pfam: BPD_transp_1
Other DBs
NCBI-GeneID: 936088
NCBI-ProteinID: NP_388592
Pasteur: BG10435
BSORF: BG10435
UniProt: P39128 A0A6M4JE53
Position
781092..782048
AA seq 318 aa
METVPKKRDAPVLTAGKGISWMAALKRDKWLYLLLIPGLLYFLIFKYLPMWGVLIAFKDY
SPYLGFWKSEWVGFDYFKDFFMNPDFFRLLRNTLMLASLDLLFAFPAPLILALLLNEVRK
AVYKRCIQTFIYVPHFVSWTIVVSITFVFFTVDTGVINKLIMSLTGEQISFLSDADWFRP
MIVMQSIWKETGWGTILFLAALATVDQEQYEAAIMDGAGRFRRMWHITLPAIRSTIIVLL
ILRIGSFLNLGFEQVYLMTNSLNRSVADIFDTYVYMMGITQGAYSYSTAVGLFKSVVGII
LIFGANYIAKKFDQEGLF
NT seq 957 nt   +upstreamnt  +downstreamnt
atggaaacagtgccgaagaagagagatgcacctgttctcaccgctggaaaaggcatcagc
tggatggctgcgctcaaacgggacaaatggctttatcttcttcttattcccggtctgctt
tatttcttgattttcaaatacttgccgatgtggggtgtgctgatcgcttttaaagactat
tcgccatatctcggcttctggaaaagcgaatgggtcggctttgattatttcaaagacttt
tttatgaatccggattttttccggctgctgcgcaacaccctcatgctggcgagtctggat
cttttgtttgcctttcccgcgcctctcattttggctctgcttttgaatgaggtaagaaag
gccgtgtataaaagatgtatccaaacctttatttacgtaccccattttgtatcatggaca
attgtggtcagcatcaccttcgttttctttactgtcgatacaggtgtgatcaacaaattg
attatgagcctgacaggtgagcagatttctttcttgtcggatgcagactggttccggcca
atgattgtgatgcaaagcatttggaaggagacaggctggggaacgattctatttttggca
gcgcttgctacggttgatcaagagcagtatgaagcggccatcatggacggagcggggcgg
ttcaggagaatgtggcatattacgctgccggcgattagaagcaccattatcgttttgttg
attttaagaatcggcagctttttgaatcttggctttgaacaggtgtatttgatgacgaac
tcactcaaccgcagtgtggctgacatcttcgacacgtatgtgtacatgatggggattacc
caaggggcgtatagctacagcacggcggtcggtttgtttaaatcagttgtcgggattatc
ttgatttttggcgccaattacattgcgaaaaagtttgatcaggaaggattgttttag

DBGET integrated database retrieval system