KEGG   Bacillus subtilis subsp. subtilis 168: BSU07120
Entry
BSU07120          CDS       T00010                                 

Symbol
lplC
Name
(RefSeq) ABC transporter permease LplC
  KO
K17320  putative aldouronate transport system permease protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    BSU07120 (lplC)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU07120 (lplC)
Transporters [BR:bsu02000]
 ABC transporters, prokaryotic type
  Saccharide, polyol, and lipid transporters
   Putative aldouronate transporter
    BSU07120 (lplC)
SSDB
Motif
Pfam: BPD_transp_1
Other DBs
NCBI-GeneID: 938767
NCBI-ProteinID: NP_388593
Pasteur: BG10857
BSORF: BG10857
UniProt: P39129 A0A6M3Z8D5
Position
782062..782949
AA seq 295 aa
MAEIHTMHNTKAGRVFDVCNILFLGGVGAITILPFLYIIAGSFATEAELAQRSFFIFPKT
FTLDAYKYVFSTPTFLRSMGVSIFITVVGTAVQLFFTFTMAYPLAKRHVKGRNLLLNLVI
FSMLFSGGMIPTYLVVKSLGLLDTYWALILPMAINPFNLIIIKNFFQQLPRELEESAKID
GCSEIGVFWRIALPLSKPVIATFALFYAVGIWNDFFHALLYINDSAKWPLQMVLRQVTIL
SDLTATNGDTMQNAVPPEQGIKLAVIVIATLPILAVYPFLQKHFAKGMLIGSVKG
NT seq 888 nt   +upstreamnt  +downstreamnt
atggctgaaattcacacgatgcacaacaccaaagccggacgggtgtttgacgtctgcaac
attctgtttctcggcggtgtcggcgcgattaccattttgccgtttttatatattatcgcc
ggttcctttgcgacagaagcggaactcgcccagcggagcttctttattttcccgaaaacc
tttacacttgatgcttacaagtatgtgttttcgacaccgacgttccttcgaagcatgggc
gtgtccatcttcatcacggtggttgggacggctgtacagctgttttttaccttcacgatg
gcgtatccgctggcgaaacggcatgtgaagggacggaatctgctgttgaatctggtgatt
ttctccatgctgttttcaggcggcatgattccgacgtaccttgtcgtaaaatcacttggc
cttttggatacgtattgggcattgattctgccgatggcgattaatccgttcaaccttatt
attatcaaaaacttctttcagcagctgccgcgcgagctggaggaatcagcaaaaattgac
ggctgttccgaaatcggcgtcttctggcggatcgccctgcctctgtcaaagccagttatt
gcgacctttgcgctgttttatgcggtcgggatttggaatgatttcttccacgctctctta
tatatcaatgacagtgcaaaatggccgctgcaaatggtgcttcgccaagtcacaatttta
tcggatttaacggcgaccaatggtgatacgatgcaaaatgcagttccgccggagcaggga
attaaactcgctgtcattgtcattgcgacgctgccgattttggcggtctatccattttta
caaaaacactttgcaaaaggaatgctgatcggttcggtgaaaggctga

DBGET integrated database retrieval system