KEGG   Bacillus subtilis subsp. subtilis 168: BSU07130
Entry
BSU07130          CDS       T00010                                 

Symbol
lplD
Name
(RefSeq) alpha-galacturonidase
  KO
K22933  galacturan 1,4-alpha-galacturonidase [EC:3.2.1.67]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00040  Pentose and glucuronate interconversions
bsu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    BSU07130 (lplD)
Enzymes [BR:bsu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.67  galacturonan 1,4-alpha-galacturonidase
     BSU07130 (lplD)
SSDB
Motif
Pfam: Glyco_hydro_4 Glyco_hydro_4C Ldh_1_N
Other DBs
NCBI-GeneID: 938770
NCBI-ProteinID: NP_388594
Pasteur: BG10858
BSORF: BG10858
UniProt: P39130 A0A6M4JJD7
Structure
Position
782958..784298
AA seq 446 aa
MFHISTLDQIKIAYIGGGSQGWARSLMSDLSIDERMSGTVALYDLDFEAAQKNEVIGNHS
GNGRWRYEAVSTLKKALSAADIVIISILPGSLDDMEVDVHLPERCGIYQSVGDTVGPGGI
IRGLRAVPIFAEIARAIRDYAPESWVINYTNPMSVCTRVLYKVFPGIKAIGCCHEVFGTQ
KLLAEMVTERLGIEVPRREDIRVNVLGINHFTWITKASYRHIDLLPIFREFSAHYGESGY
ELEGECWRDSVFCSAHRVAFDLFETYGAIPAAGDRHLAEFLPGPYLKQPEVWKFHLTPIS
FRKQDRAEKRQETERLIVQQRGVAEKASGEEGVNIIAALLGLGELVTNVNMPNQGQVLNL
PIQAIVETNAFITRNRVQPILSGALPKGVEMLAARHISNQEAVADAGLTKDTGLAFQAFL
NDPLVQIDRSDAEQLFNDMLQCIMQS
NT seq 1341 nt   +upstreamnt  +downstreamnt
gtgtttcatatcagtacattagatcagattaagattgcctatatcggcggggggtcccaa
ggctgggccagaagcctgatgagtgatttgtcgattgatgaacggatgtcaggcacggtg
gcgctctatgatcttgattttgaagccgctcagaaaaatgaagtgatcggcaatcacagc
gggaacggcagatggagatatgaggctgtttctactttgaaaaaggcgttatcagccgcg
gatatcgtcattatttccattttgccgggatcactggatgatatggaagtcgatgtgcac
ttgcctgagcgctgcggtatttatcagtctgtaggtgatactgtcgggcctggagggatc
atcaggggcttgcgtgctgtgccgatatttgcggaaattgcccgggcaataagagactac
gcacctgaatcatgggtcattaattatacaaacccgatgtctgtctgtacaagagtgctg
tataaagtgtttcccggcatcaaagcgattggctgctgccacgaggtattcgggacgcaa
aagctattggcggaaatggtcacggaaaggctggggattgaggtgccgcggcgtgaggat
atccgcgttaatgtgctcggcattaaccattttacatggatcacaaaagcctcttaccgc
catattgacctgttgcctatattccgtgaattcagcgcgcactatggggaatcaggatat
gagctggagggggaatgctggagggacagcgtcttttgttcggcacaccgtgttgcgttt
gatttatttgaaacgtatggcgccatccctgctgcgggtgacaggcatctggcagagttt
cttcccggcccatacctcaaacagcctgaagtatggaaatttcatctcacacctatatca
ttcagaaaacaagacagagctgagaaacgacaagaaacagaacggttgatcgtgcaacaa
cggggcgttgctgagaaagcttcgggagaagaaggcgtgaacatcatagcggctcttctc
ggattgggtgaactcgtcacaaatgtaaatatgccgaatcaaggccaggtcttaaacctt
cctatacaagccattgtcgaaacaaacgcattcatcacaaggaaccgtgtccagccgatt
ttgtccggagcgcttccgaaaggtgtggaaatgctggcggctaggcatatatccaatcag
gaggcagtggcggacgcaggtttaacaaaggatactggcctcgcgtttcaagccttcctc
aatgacccgcttgtccagattgaccgcagtgatgcagagcagcttttcaatgacatgctc
caatgcatcatgcaaagctga

DBGET integrated database retrieval system