KEGG   Bacillus subtilis subsp. subtilis 168: BSU07140
Entry
BSU07140          CDS       T00010                                 

Symbol
yetF
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: DUF421 MinC_N
Other DBs
NCBI-GeneID: 936086
NCBI-ProteinID: NP_388595
Pasteur: BG12862
BSORF: BG12862
UniProt: O31533 A0A6M3ZBK7
Structure
Position
784381..785076
AA seq 231 aa
MGNYLSVAVELVCGLGILFIILKLLGKTQFSQITPFDFISALILGELVGNAVYDHEIKIK
EIIFASLLWGVLIYIIEFITQKMKSSRKFLEGEPNIVIRKGELQYKVMKKNKIDINQLQS
LLRQAGSFSIQEVEYAILETNGMVSVLPKSDFDKPTNKDLQIPSKSVSLPITLIIDGEIV
RDNLKEAGVDEQWLKQELKKKNIDKTEDVLFAEWHKNKPLYTVTYEQSRST
NT seq 696 nt   +upstreamnt  +downstreamnt
atgggaaattatttaagtgttgcggtagaactggtctgcggtttaggcattttatttatc
atcttaaagcttctcgggaaaacccaattttctcaaattacgccgtttgactttatttct
gctttaattttaggtgaattggtcggaaatgccgtctacgatcatgaaatcaaaatcaaa
gaaattatttttgcttcgctattgtggggcgtgctgatttatattattgaatttatcacg
caaaaaatgaaatcatcgcgaaagttcttggagggcgagccgaatatcgtcatccgcaaa
ggggagcttcaatataaagtaatgaagaaaaataagatagacattaaccagctgcaaagc
ctattgaggcaagctgggagcttttcgatccaagaagtagaatatgcgattcttgaaaca
aacgggatggtcagcgtgcttccaaaatcagactttgacaaaccgacaaataaggatttg
cagattccttcgaagtccgtttctctgccgatcacgttaatcatagatggagagattgtg
cgggataatttgaaggaagcaggtgtggatgaacagtggctgaaacaagaattgaaaaag
aagaacattgataagacagaggacgtgttatttgcagaatggcataaaaataagccgctg
tatactgtaacgtacgaacaaagcagatcaacatga

DBGET integrated database retrieval system