KEGG   Bacillus subtilis subsp. subtilis 168: BSU07150
Entry
BSU07150          CDS       T00010                                 

Symbol
yetG
Name
(RefSeq) monooxygenase
  KO
K07145  heme oxygenase (staphylobilin-producing) [EC:1.14.99.48]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00860  Porphyrin metabolism
bsu01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin metabolism
    BSU07150 (yetG)
Enzymes [BR:bsu01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.99  Miscellaneous
    1.14.99.48  heme oxygenase (staphylobilin-producing)
     BSU07150 (yetG)
SSDB
Motif
Pfam: ABM
Other DBs
NCBI-GeneID: 936085
NCBI-ProteinID: NP_388596
Pasteur: BG12863
BSORF: BG12863
UniProt: O31534 A0A6M4JDW1
Position
complement(785113..785490)
AA seq 125 aa
MNFIYNYSYVRMIGVRQMFVQLRKMTVKEGFADKVIERFSAEGIIEKQEGLIDVTVLEKN
VRRGDEEVVVMIRWESEDHWKQWEKSDAHIAGHKANKGKPKPDYLISTEVSMYHVRAVKQ
GTYNQ
NT seq 378 nt   +upstreamnt  +downstreamnt
atgaatttcatttacaattattcatatgtgagaatgattggagtgagacaaatgtttgta
cagttgagaaaaatgacggttaaagaaggctttgcagataaagtcatagaacgtttcagc
gctgaaggaatcattgaaaaacaagaaggtttaattgatgtgacagtgcttgagaaaaat
gtgcgccgcggtgatgaagaagttgttgtcatgattcgctgggaatcagaggatcactgg
aagcaatgggaaaaaagcgatgcgcatatcgccggccataaagcaaacaaaggcaaacca
aagcctgactatctgatcagcactgaagtgagcatgtaccatgtacgtgctgtcaaacaa
gggacatacaatcaataa

DBGET integrated database retrieval system