KEGG   Bacillus subtilis subsp. subtilis 168: BSU07160
Entry
BSU07160          CDS       T00010                                 

Gene name
yetH
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: Glyoxalase Glyoxalase_2 Glyoxalase_6 SPO11_like Glyoxalase_7
Other DBs
NCBI-GeneID: 938777
NCBI-ProteinID: NP_388597
Pasteur: BG12864
BSORF: BG12864
UniProt: O31535 A0A6M3ZDK7
Position
complement(785543..785905)
AA seq 120 aa
MIKQIGTVAVYVEDQQKAKQFWTEKVGFDIAADHPMGPEASWLEVAPKGAETRLVIYPKA
MMKGSEQMKASIVFECEDIFGTYEKMKTNGVEFLGEPNQMEWGTFVQFKDEDGNVFLLKE
NT seq 363 nt   +upstreamnt  +downstreamnt
atgatcaaacaaattggcactgttgctgtatatgtcgaggaccagcagaaagcgaagcaa
ttttggacagagaaggtaggctttgatattgcagcggatcacccaatgggacctgaagca
agctggctggaggttgcgccaaaaggagccgagactcgtttagtcatttacccgaaagcc
atgatgaaaggctcagagcaaatgaaggcttctattgtgtttgaatgcgaagacatcttt
ggtacatacgagaaaatgaagacaaacggtgtagaatttctcggtgagcccaatcaaatg
gagtggggcaccttcgttcaatttaaggacgaagacggaaatgtgtttttattaaaagaa
taa

DBGET integrated database retrieval system