KEGG   Bacillus subtilis subsp. subtilis 168: BSU07190
Entry
BSU07190          CDS       T00010                                 

Symbol
yezD
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: DUF2292
Other DBs
NCBI-GeneID: 938773
NCBI-ProteinID: NP_388600
Pasteur: BG12875
BSORF: BG12875
UniProt: O31538 A0A6M4JG95
Position
787715..787882
AA seq 55 aa
MVSKSTIDPEVIEKIISSLETLDFGTVQITVHDSQITQIEKIEKHRFSLKRKESK
NT seq 168 nt   +upstreamnt  +downstreamnt
ttggtttctaaatcaacgattgatccggaagtgattgaaaaaatcatcagctcgctggaa
acactcgatttcggcacggttcagattacggttcatgattctcagattacccaaattgag
aaaatagaaaagcaccgtttttcgctgaaaaggaaagaatcaaaatga

DBGET integrated database retrieval system