KEGG   Bacillus subtilis subsp. subtilis 168: BSU07200
Entry
BSU07200          CDS       T00010                                 

Symbol
yetJ
Name
(RefSeq) hypothetical protein
  KO
K06890  uncharacterized protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    BSU07200 (yetJ)
SSDB
Motif
Pfam: Bax1-I
Other DBs
NCBI-GeneID: 938782
NCBI-ProteinID: NP_388601
Pasteur: BG12866
BSORF: BG12866
UniProt: O31539 A0A6M4JFX2
Structure
PDB: 

Position
787992..788636
AA seq 214 aa
MQATVHESKQSIMQRILTVFVFTLLIATVGLFIGQFVPVALMLPLSILEVAMIILAFWMR
RRKAVGYAFVYTFAFVSGITLFPIVSHYASIAGAYVVLEAFGSTFVIFAVLGTIGAKMKK
DLSFLWSFLLVAVLALAVVGIFNIFSPLNSAAMMAYSVIGTIVFSLYILYDLNQIKHRHI
TEDLIPVMALSLYLDFINLFINLLRFFGILSSDD
NT seq 645 nt   +upstreamnt  +downstreamnt
atgcaagctacggttcacgagagtaagcaatcgatcatgcaacgcattttgacagtcttt
gtcttcacattgctgatcgcgactgtcggcctttttatcggccaatttgttcctgtcgct
ttgatgctgccgctttctattcttgaagtggcgatgattattctggccttctggatgcgc
agaagaaaagcggtcgggtatgcgtttgtatatacattcgcgttcgtttccggcattacc
ttatttccgatcgtcagccattacgcttccatcgccggcgcctatgtcgtgctcgaagcc
tttggctctacatttgtcatttttgccgtcttgggcacaatcggcgcaaaaatgaagaag
gatttatccttcctgtggtcgtttctgctggttgcggtgctcgcactcgcagtggtaggg
attttcaacattttcagcccgttaaactcagcggcgatgatggcgtattccgtgatcgga
accatcgtcttttccctttacattttgtatgatttgaaccaaatcaagcaccgccacatt
acggaagacttgattccggttatggcgttatcgctgtacctagactttatcaacttgttc
atcaacctgctccgcttcttcggcattttgagcagtgatgattaa

DBGET integrated database retrieval system