KEGG   Bacillus subtilis subsp. subtilis 168: BSU07210
Entry
BSU07210          CDS       T00010                                 

Gene name
yetK
Definition
(RefSeq) transporter
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: EamA SLC35F Insulin_TMD
Other DBs
NCBI-GeneID: 936091
NCBI-ProteinID: NP_388602
Pasteur: BG12867
BSORF: BG12867
UniProt: O31540 A0A6M3Z876
Position
788636..789628
AA seq 330 aa
MKKRLSLDRRFLPYIKKAGGVLVKKQMGAYVSLAAAMAIVGSSVVVGKLMVERIPVFLSS
GLRFLIASVVLLMLLFCIEKGFPALTKKDVFVLLVQSFTGVFLFSICLLYGVQYTTGTES
GILTSTTPMLIGILSFFLLREKIEKKTLIGILLAVCGVMAINLFGAGSQDGTPHALFGNM
LIIAAVIGEALFTLMAKLLSPHISALAISTFVSLFGFLFFLPFALFEASSFDYSVPTVLD
WSYVLYYALFVTVLAFYLWYSGVTKVPAGVSGIFTSVLPVSAVILSGVILKEPFEFVHFI
GIACVIGGIFVTVIKKKQPDAYPAAEEKTL
NT seq 993 nt   +upstreamnt  +downstreamnt
atgaaaaagcgtctgtcattggataggcgctttttgccatacatcaaaaaggcaggtgga
gtattggtgaaaaaacaaatgggcgcatatgtatctctggcagcagctatggcgatcgtc
ggcagttctgtcgttgtcggcaagctgatggtcgaacggattccggtctttctttcctca
ggattgcgttttttgatcgcttctgtcgtattgctcatgctgctgttttgcattgaaaaa
gggtttccggctttgacgaaaaaagatgtgttcgtattactggtgcaatcattcacaggc
gtgtttttgttcagtatttgcctgctgtatggggttcaatatacgacgggaacggaaagc
ggcattttgacaagcacaacccccatgttgatcggtattttatcctttttcctgctgaga
gaaaaaattgagaaaaagacgctgatcggcattttgctggcggtttgcggcgtaatggcg
attaatttgtttggagccgggagccaagacgggacgccgcacgccttattcgggaacatg
ctgatcattgctgcagtcattggcgaagcgttgtttacattgatggccaagctgctatcc
ccgcatatttcggcactggcgatttcgaccttcgtatcgctcttcggcttcctgtttttt
ctcccgtttgctttgtttgaggcctcttcatttgattacagcgtgccgactgttttggat
tggtcgtatgtgctgtattacgcgctttttgtcactgttttggcgttttacttatggtat
agcggggtgacgaaggtgccggcgggtgtatcgggcattttcacatccgttcttccggtc
tcagctgtcattttgtcaggcgtgatattgaaggagccatttgagtttgtgcatttcatc
ggcattgcatgtgtcatcggcggcatatttgttacggtcataaagaaaaaacagccggat
gcgtatccggctgcagaagaaaagacgctatag

DBGET integrated database retrieval system