KEGG   Bacillus subtilis subsp. subtilis 168: BSU07220
Entry
BSU07220          CDS       T00010                                 

Symbol
yetL
Name
(RefSeq) MarR family transcriptional regulator
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: MarR MarR_2 HTH_IclR HTH_11 HTH_34 TrmB HTH_27 HxlR Fe_dep_repress HTH_24 HTH_Crp_2 Rrf2 DUF1495 HTH_31 HTH_26 HTH_45 PadR
Other DBs
NCBI-GeneID: 938778
NCBI-ProteinID: NP_388603
Pasteur: BG12868
BSORF: BG12868
UniProt: O31541 A0A6M3Z8C5
Position
complement(789652..790155)
AA seq 167 aa
MELKHLPKYKHITEHAETYANIDAGSLELFLSLFDISKKMNHVMEHYFAGRGLSEGKFKI
LMLLFDAKDHRLSPTELAKRSNVTKATITGLLDGLARDGFVSRRHHTEDKRKISIELTTE
GKARLEQFLPGHFSKISAVMENYSDEEKDMFVKMLGDLFERLSVFKD
NT seq 504 nt   +upstreamnt  +downstreamnt
atggaattaaaacatttaccgaaatataagcatataacagagcacgccgaaacgtatgcc
aatattgacgccggctctcttgaattgtttttatctctttttgatatttcaaaaaaaatg
aatcatgtgatggagcattactttgctggccgagggctttcagaaggaaaattcaaaatc
ctgatgctgctctttgatgccaaggatcataggttaagtccgacagagcttgccaagcgg
tcaaatgtcacgaaagcaacaattacaggcctgctagacgggctggcgagagacggtttt
gtcagccgcaggcatcacacagaggataaacgaaaaatcagcattgaactgacaacagaa
ggcaaagcacgcctggagcaatttctgcccggccatttcagcaaaatatccgctgtcatg
gaaaactacagcgacgaggaaaaagacatgttcgtgaagatgcttggtgatctttttgaa
aggctgagcgtgtttaaagactaa

DBGET integrated database retrieval system