KEGG   Bacillus subtilis subsp. subtilis 168: BSU07230
Entry
BSU07230          CDS       T00010                                 

Symbol
yetM
Name
(RefSeq) oxidoreductase
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: FAD_binding_3 Pyr_redox_2 DAO Pyr_redox NAD_binding_8 Trp_halogenase FAD_binding_2 Amino_oxidase FAD_oxidored HI0933_like SE GIDA
Other DBs
NCBI-GeneID: 936090
NCBI-ProteinID: NP_388604
Pasteur: BG12869
BSORF: BG12869
UniProt: O06489 A0A6M4JKZ1
Position
790318..791427
AA seq 369 aa
MKHMLIAGGGIGGLSAAISLRKAGFSVTLCEAASENRKTGAGILQPQNALAVLKELGVFE
DCCKHGFQTEWFKTFDEQGNLLFQVSESFLDDSLPGRNNILRKTLNDILMKHAEAVGVDI
KWGKKVVAYEETAESVTALCEDGEKMQADILAGFDGIHSVVRDKMLQKETEKEHLGMGAW
RFYIELPDYTFEDATFMYRSGDTQIGVVPLAQHAGYVFVLQPCTSDYWDEEDTRFDRVKE
ILSGFRGLDFVTKHMSKQHPVIFNKLEQVAVQEPWHKGRVIIGGDAAHAGAPTLAQGAAM
AIEDAIVLAEELQNHADHETALQAYYKRRAPRALKVQNLSSEIVRRRLKGEPGAEELIGE
CYAVLREGY
NT seq 1110 nt   +upstreamnt  +downstreamnt
atgaaacatatgttaatagcaggaggcggaatcggcggcttgtcagcggccatttctctc
cgtaaggcagggttttccgtcaccttatgtgaagcggcttcagaaaatcgaaaaacaggt
gcggggattcttcagccgcaaaacgcactggcggtgttgaaagaactgggcgtattcgaa
gattgctgtaagcacggctttcaaacagaatggtttaaaacgtttgatgaacaggggaat
ttgctgtttcaagtcagtgaatcctttttagacgattcacttccgggacgcaataatatc
ctgcgcaaaacgttaaatgacattctcatgaagcatgccgaggcagtgggtgtagacatc
aagtgggggaaaaaggttgtcgcctatgaagaaactgctgaatcggtcactgccttatgt
gaagatggagaaaagatgcaggctgacattctggcgggctttgacggcattcactccgtt
gttcgtgataagatgctgcaaaaggaaacggaaaaagagcatctcggcatgggagcgtgg
cgcttttatatcgaacttcctgattacacattcgaggacgcaacattcatgtatagaagc
ggagacacacaaatcggggtggtgccattggcacaacacgctggctatgtcttcgtcctc
cagccttgcacgagcgattactgggatgaggaagatacccggtttgatagagtaaaagag
attctttctggttttcgggggctggattttgtcacaaagcacatgtcaaaacagcatcct
gtcatctttaacaaactggagcaggtcgccgtgcaggagccatggcataaaggccgcgtc
atcatcggaggagacgccgcccacgccggtgcgccaaccctggcacaaggagcggcaatg
gcgatcgaggatgccatcgtcctcgccgaagaactccaaaaccacgccgaccacgaaaca
gcattacaggcgtactataaaagaagagccccacgagcgctcaaagtccagaacctatca
tctgaaatcgtccgccgcaggctgaaaggagagccgggagcggaagaactgattggggag
tgctatgcggtgttgagggaagggtattaa

DBGET integrated database retrieval system