KEGG   Bacillus subtilis subsp. subtilis 168: BSU07240
Entry
BSU07240          CDS       T00010                                 

Symbol
yetN
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: DUF3900 DUF3898
Other DBs
NCBI-GeneID: 936089
NCBI-ProteinID: NP_388605
Pasteur: BG12870
BSORF: BG12870
UniProt: O06490 A0A6M4JJE4
Position
complement(791462..792532)
AA seq 356 aa
MDFEIRFLSFYVIQVEGKDEQANKQFKHFQTLDTGEFEESELKDFLDGELKKIVKRKADR
HPQSEQVPTKIGHFIVEPGHELDSNPNYNMFNRARLAETKEDFNELSEQFVRTYLDTSAV
RGGVFLVASAVPRKYFDESFVFIMKCDFEPKVARISDASSLIKKVEMAITTKNMKSIQYP
YMPEEGMVEEGELKIHQASHARYFEDFLKFVEYGESMPEIMKNQVMNMVQEHVYETFEDN
SEELKQFEHDIEIWEASEKREIQERLDTHQVIEASAQIIEHTPEAQLKMKVGETEIKGLL
ADFGDSIHLAKVNGRYVALIEAETISFEKGSSPVEFYKPEGLHEVIERIRNKTEQD
NT seq 1071 nt   +upstreamnt  +downstreamnt
atggattttgaaattcggtttttatccttttatgtcatacaggtggaaggcaaagatgag
caggcgaacaagcagttcaagcacttccagacccttgatacgggagaatttgaagaaagc
gagctgaaggactttctcgacggggaactgaaaaaaatcgttaaacggaaagccgaccgc
catccgcagtccgagcaggtgccgacgaaaatcggccattttatcgtcgagcccggccac
gagctcgattccaacccaaactacaacatgttcaaccgcgcgcgtctggcggaaacaaaa
gaagacttcaatgagctgagcgagcagttcgtccgcacgtaccttgacacaagcgcggtt
cgcggcggcgtgtttctcgtcgcttcggccgtgccgagaaaatactttgatgagtcattt
gtcttcattatgaaatgtgattttgagccgaaggtcgcccgcatctctgacgcgtcttct
ctcattaaaaaagtcgaaatggcgatcacgacaaaaaacatgaaaagcatccaatacccg
tacatgccagaggaaggaatggtcgaggaaggtgaactgaaaatccaccaggcctcgcac
gcccgctattttgaggactttctgaaattcgtcgagtacggagaatcgatgccagaaatc
atgaaaaatcaggtcatgaacatggtacaagagcacgtctacgagacatttgaagacaac
agcgaagaactcaagcagttcgagcacgacattgagatttgggaagcaagcgaaaaacgg
gaaatccaagagcgcctcgacacccatcaagtcatcgaagcctccgcccaaatcatcgag
cacacgccagaggcccagctgaaaatgaaagtcggagaaacagagattaagggattgcta
gcggattttggcgattctattcatctcgcaaaagtaaacgggcgctatgtcgcgctgatt
gaagccgagacgatttcgtttgagaaaggcagttcaccggtggagttttataagcctgag
gggctgcatgaggtgattgagcggataaggaataaaacagagcaagactaa

DBGET integrated database retrieval system