KEGG   Bacillus subtilis subsp. subtilis 168: BSU07280
Entry
BSU07280          CDS       T00010                                 

Gene name
yfnG
Definition
(RefSeq) CDP-sugar-dehydratase/epimerase
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: GDP_Man_Dehyd Epimerase Polysacc_synt_2 3Beta_HSD NAD_binding_4 RmlD_sub_bind
Other DBs
NCBI-GeneID: 938783
NCBI-ProteinID: NP_388609
Pasteur: BG12978
BSORF: BG12978
UniProt: O06485 A0A6M3ZDL6
Position
799303..800208
AA seq 301 aa
MVKELIEQGANVTGLVRDHVPQSNLYQGEHIKKMNIVRGSLEDLAVIERALGEYEIDTVF
HLAAQAIVGVANRNPISTFEANILGTWNILEACRKHPLIKRVIVASSDKAYGDQENLPYD
ENMPLQGKHPYDVSKSCADLISHTYFHTYGLPVCITRCGNLYGGGDLNFNRIIPQTIQLV
LNGEAPEIRSDGTFVRDYFYIEDAVQAYLLLAEKMEENNLAGEAFNFSNEIQLTVLELVE
KILKKMNSNLKPKVLNQGSNEIKHQYLSAEKARKLLNWTPAYTIDEGLEKTIEWYTEFFK
K
NT seq 906 nt   +upstreamnt  +downstreamnt
ttggtgaaagagctgatcgaacagggcgcaaacgttacggggctagtcagggatcatgtg
cctcaatccaatctttatcagggagaacatatcaagaaaatgaacatcgtgcggggctct
cttgaggacttggctgtgattgaacgcgcgcttggcgagtatgagatcgacacagtcttt
catcttgctgcacaagcgattgtcggcgtggcaaaccgcaacccgatttctacctttgaa
gcgaatatcctcggcacctggaatattctcgaagcctgccgcaagcatccgttaattaag
cgggtcattgtcgcttcaagtgataaagcttacggcgatcaagaaaaccttccatacgat
gaaaacatgccgctgcaaggcaagcacccgtacgacgtctcaaaaagctgcgcagatctg
atcagccacacctattttcacacgtacgggcttccggtctgcattacgcgctgcggaaac
ttatacggcggcggagatttgaacttcaaccgcatcattcctcagacgattcagcttgtg
ctgaacggggaagcgccggaaatccgaagcgacggcacatttgtacgggactacttctat
attgaagacgccgttcaggcttatctgcttcttgcagaaaaaatggaagaaaacaatctt
gccggagaggcctttaacttcagcaatgagatccagctgaccgtacttgaactggtagag
aaaatattaaagaaaatgaacagtaatctgaaacctaaggtgctgaatcagggaagcaat
gaaatcaaacatcaatatttatccgcggaaaaagcaagaaagctgctgaattggacaccg
gcctacactattgatgagggacttgaaaaaacgattgagtggtatacggaattcttcaaa
aagtaa

DBGET integrated database retrieval system