KEGG   Bacillus subtilis subsp. subtilis 168: BSU07300
Entry
BSU07300          CDS       T00010                                 

Symbol
yfnE
Name
(RefSeq) glycosyltransferase YfnE
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: Glycos_transf_2 Glyco_tranf_2_2 Glyco_tranf_2_3 Glyco_transf_21 Glyco_transf_7C Glyco_trans_2_3 Glyco_transf_49 Glyco_tranf_2_4 Helicase_C
Other DBs
NCBI-GeneID: 938781
NCBI-ProteinID: NP_388611
Pasteur: BG12976
BSORF: BG12976
UniProt: O06483 A0A6M3Z8S6
Position
801172..802350
AA seq 392 aa
MKASVIIPAYNSKERLYNSLLSLNQQECDEEFEVIVADNGSEDGTLSMLESFQADFPLIF
TRIKENRGIAYGRNQALRNARGDILIFHDSDMLAAKDLVAKHIKAHENEENLVVCGLFWK
RIYSFYYERFEEEHKEQLAKLTGEMPKKDKQKLLEEADIKNGSFLDKSFDLDTDFIDVLK
KILDEYGDDLKGYHMPWRFFITNNSSVKRKHVVDLGLFDEGIVRYGFEDYDLGIRLHQAG
LTFRLRRDIVSVHQEHPSNCKSVDDIRANIAYMCDKYNNIRSLDVHLAFNGPFPPDMTNR
IMADIQKLLESQKYDMLLNLFLELLHVVKERNIDPDWRKKSPRVTAKSFDLQTVRKLLPK
AKKKLGVNDFANALYALVNDLLHVDLRSLDVV
NT seq 1179 nt   +upstreamnt  +downstreamnt
gtgaaagcaagcgttattattcctgcatataattcgaaggagcgtctttacaacagcctt
ctgtcattaaaccagcaggagtgcgatgaagaatttgaagtcattgtagcggacaatggc
tctgaggacgggacgctctcgatgcttgagtcatttcaagctgattttccgctgatcttt
acacggattaaagaaaacaggggcattgcgtacggacgaaatcaggcgcttcgcaatgcc
agaggagacatcctgattttccatgacagcgatatgcttgcggcaaaggaccttgtggca
aaacatattaaagcccatgagaacgaagagaatctcgtcgtgtgcgggttgttttggaaa
cggatctacagtttttactatgaacgatttgaagaagaacataaggaacagctcgcaaag
ctcacaggtgaaatgccgaagaaagacaaacaaaagctgctggaggaagcggacatcaaa
aacggaagctttcttgataaaagctttgacctcgataccgactttatagacgtgctcaag
aagattttagatgagtacggcgatgacttgaaaggctatcatatgccatggcgctttttt
atcacgaataattcctctgtgaaacgcaagcatgtggttgacctcggtttatttgacgaa
ggcattgtgcggtacgggtttgaggattatgacctcgggatcaggcttcatcaggccgga
ttgaccttcaggcttcgccgtgatattgtcagtgttcatcaggaacatccaagcaattgt
aagtctgtagacgatattcgggcaaacattgcctatatgtgcgataaatacaataacatc
cgctccttagacgttcatctcgcttttaatgggccgttcccgcctgacatgacgaacaga
atcatggctgatattcaaaagctgctggaatcacagaaatatgatatgctgctgaatctg
tttcttgagcttctgcatgttgttaaagagcgcaacattgatccggattggcgaaagaaa
tccccaagggtgacggcgaaaagctttgatttgcaaactgtccgcaagcttctgcctaag
gcgaagaaaaagctaggcgtgaacgattttgccaacgcactgtatgcgcttgtcaacgat
ttgctgcacgtggatcttagatcattggatgtggtataa

DBGET integrated database retrieval system