KEGG   Bacillus subtilis subsp. subtilis 168: BSU07310
Entry
BSU07310          CDS       T00010                                 

Symbol
yfnD
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: Nucleotid_trans
Other DBs
NCBI-GeneID: 936096
NCBI-ProteinID: NP_388612
Pasteur: BG12975
BSORF: BG12975
UniProt: O31542 A0A6M3Z8C8
Position
802351..803286
AA seq 311 aa
MSTFHFSTIVSRTHIFKLMPMIHSLHEHCDDFHLYVLCVDQKAYELLQHVPWEHVTFVQL
HEMEDPELLKAKSNRTFHEYCWTLKPAFLFHVMSKWDDAEYFAHMDTDLFFFSDPARIFA
ENPTASLYLTDHRNSPRFMSYYDRTGRFNTGFVGAGNTKEAYEAVWQWRQDCIEFCTVEM
DTERKTYGDQRYVEKWPEQFKGVHVVKSIGANTALWNIENYKVGQKDGRVYIDETPLIFY
HFSGFTLVTEKEFNLCWYYRIEDEATIKMIYMPYILNLKRWIDEIQSAFPDFADGFIPKH
AVPDTHFIQLD
NT seq 936 nt   +upstreamnt  +downstreamnt
gtgagtacatttcatttttcaacgatagtgtcaaggacacatatctttaagctcatgcct
atgattcattctctccatgagcattgcgatgattttcatttatatgtgctgtgtgtcgac
cagaaagcgtatgaattgcttcagcacgttccatgggagcatgtaacctttgtgcagctg
catgaaatggaagacccggagctgttgaaagcgaaaagcaacagaacgtttcatgaatat
tgctggacgttaaagcccgcctttttgtttcatgtgatgagcaagtgggatgacgctgaa
tactttgcccatatggatacggatctatttttcttttctgatccggcacgtatttttgca
gaaaacccaacggcgtctctgtatttgactgatcatcgtaattcgccgcgcttcatgtcc
tactacgaccgaaccggacgctttaatacaggctttgtcggcgccggtaatacaaaggaa
gcatatgaagcggtgtggcagtggagacaggactgtattgaattttgcacggtcgaaatg
gatacggaacgaaagacatatggtgatcaaagatatgtggagaaatggccggagcagttt
aaaggtgttcatgttgtcaaatccataggagccaatacagcgctttggaatatcgaaaac
tataaggtcgggcaaaaggacggccgcgtgtatatagatgaaacgccgctgattttctat
catttctctgggtttacgctggtgacagaaaaagagtttaatctttgctggtactaccgg
attgaagacgaagcgacaattaagatgatttatatgccctatatattaaatctgaaaaga
tggattgatgaaatacagtcggcgtttccggactttgcggatggctttatcccgaagcac
gcagtgcctgacactcattttatccagctggattaa

DBGET integrated database retrieval system