KEGG   Bacillus subtilis subsp. subtilis 168: BSU07320
Entry
BSU07320          CDS       T00010                                 

Symbol
yfnC
Name
(RefSeq) MFS transporter
  KO
K08223  MFS transporter, FSR family, fosmidomycin resistance protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU07320 (yfnC)
Transporters [BR:bsu02000]
 Major facilitator superfamily (MFS)
  Drug transporters
   Fosmidomycin resistance (Fsr) family [TC:2.A.1.35]
    BSU07320 (yfnC)
SSDB
Motif
Pfam: MFS_1 MFS_2 OATP
Other DBs
NCBI-GeneID: 936104
NCBI-ProteinID: NP_388613
Pasteur: BG12974
BSORF: BG12974
UniProt: O06481 A0A6M3Z885
Position
complement(803317..804546)
AA seq 409 aa
MAIAAPLKEKTVQKPGTTVYPILIIIGICHMLNDSLQAVIPAMFPILERSMSLTFTQLGI
IAFTLNMVSSVMQPVVGWYTDKRPRPYALPVGLTASMLGILGLAFAPSFITILCCVFFIG
LGSAIFHPEGSRVAYMAAGTKRGLAQSIYQVGGNSGQAMAPLITALILVPLGQFGAVWFT
LVAALAVMFLMYIAKWYASRLGSLAQKSGKQKKTAENTAITKSVVSALIIIIFLIFARSW
YTSAIGNFYTFYAMDTYHVSIQQAQSYIFVFLLFGAIGTFLGGPLADRFGKRFVILGSLL
CSAPLAIVLPFAGPVLAYGVLALIGLVLMSSFSVTVVYAQELVPGKIGTMSGLTVGLAFG
MGAIGAVALGALIDAAGLTPTMIAIAFLPVLGILAFLLPSDQKLREWHS
NT seq 1230 nt   +upstreamnt  +downstreamnt
atggctatcgccgccccgttaaaagaaaaaacagttcaaaaaccaggcaccacggtgtat
ccgattttgattattatcggaatttgccatatgctcaacgattcgcttcaggctgtgatt
ccggccatgttccctattttggaacgctccatgagcctgacgtttacacagctcggcatc
attgctttcacattaaacatggtgtcatccgtcatgcagcctgttgtcggctggtatacc
gataaacggccgcggccgtatgcgctgccagtcggtttgaccgccagcatgcttggcatt
ttgggccttgcatttgccccgtcattcataacgatcttatgctgtgtgtttttcattgga
ttaggctcggccattttccatccggagggctcccgtgtggcgtatatggccgccggcaca
aaacgcgggctcgcccaatcgatttatcaggtgggcggaaactcaggccaggcgatggca
ccgctgatcaccgcgctgatccttgtgccgctcgggcaattcggcgctgtttggttcacg
cttgtcgccgcgcttgctgttatgtttctcatgtatattgcgaaatggtacgcctcacgt
ctcggcagccttgcccagaaatcaggcaagcaaaagaaaacggctgaaaacacggccatc
accaaatctgttgtatctgctcttattattattatatttctcatttttgctcgttcttgg
tatacgagtgcgatcggtaacttttacacgttttacgcgatggatacctatcacgtaagc
attcagcaggcacaaagctatatttttgtcttcttgctgttcggcgcgatcggcacgttt
ctcggcggcccgcttgcagaccgttttggaaaacgcttcgttatcctcggttcgctgtta
tgctcggcgccgctggcgattgtgctgccatttgccggcccggttctcgcctacggcgtg
ctcgcattgattggcttggttctgatgtcgagcttttctgtaacggtcgtctacgcacag
gagctagttcctggaaaaatcggcacaatgtccggtttaaccgtcgggcttgccttcggg
atgggcgcaatcggcgctgtggcgctgggcgctctgattgatgccgcgggactgaccccg
acgatgatcgccattgcctttctccctgtcctcggcatccttgccttcctattgccaagt
gaccagaagctgagagaatggcatagctga

DBGET integrated database retrieval system