KEGG   Bacillus subtilis subsp. subtilis 168: BSU07330
Entry
BSU07330          CDS       T00010                                 

Symbol
yfnB
Name
(RefSeq) HAD-hydrolase YfnB
  KO
K01560  2-haloacid dehalogenase [EC:3.8.1.2]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00361  Chlorocyclohexane and chlorobenzene degradation
bsu00625  Chloroalkane and chloroalkene degradation
bsu01100  Metabolic pathways
bsu01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    BSU07330 (yfnB)
   00361 Chlorocyclohexane and chlorobenzene degradation
    BSU07330 (yfnB)
Enzymes [BR:bsu01000]
 3. Hydrolases
  3.8  Acting on halide bonds
   3.8.1  In carbon-halide compounds
    3.8.1.2  (S)-2-haloacid dehalogenase
     BSU07330 (yfnB)
SSDB
Motif
Pfam: HAD_2 Hydrolase Hydrolase_like HAD Hydrolase_6 Peptidase_M19
Other DBs
NCBI-GeneID: 936095
NCBI-ProteinID: NP_388614
Pasteur: BG12973
BSORF: BG12973
UniProt: O06480 A0A6M4JE68
Structure
Position
complement(804657..805364)
AA seq 235 aa
MKRYRTLLFDVDDTILDFQAAEALALRLLFEDQNIPLTNDMKAQYKTINQGLWRAFEEGK
MTRDEVVNTRFSALLKEYGYEADGALLEQKYRRFLEEGHQLIDGAFDLISNLQQQFDLYI
VTNGVSHTQYKRLRDSGLFPFFKDIFVSEDTGFQKPMKEYFNYVFERIPQFSAEHTLIIG
DSLTADIKGGQLAGLDTCWMNPDMKPNVPEIIPTYEIRKLEELYHILNIENTVSC
NT seq 708 nt   +upstreamnt  +downstreamnt
atgaagcgataccgcactttattatttgatgtagatgataccatccttgattttcaagcg
gcagaagctttagccctgcgtttgctgtttgaagatcagaacattcctttaacaaatgac
atgaaggcgcagtataaaaccatcaatcaaggtctctggagagcctttgaagaaggtaag
atgacacgggatgaagtcgtaaacacacgtttttccgctttgctcaaggagtacggttac
gaagcggacggcgctttgcttgagcaaaaataccgccgctttcttgaagaaggacatcag
cttattgacggtgcatttgatctcatctcaaatctgcagcaacagtttgatttgtacatc
gtgacaaacggcgtgtctcacacacaatataagcgtctccgtgattcaggattatttcca
ttcttcaaggacattttcgtttctgaagacaccggcttccaaaagccgatgaaggaatat
ttcaattacgtgtttgaacggattcctcaattttcagcagagcacacattaatcatcggg
gattcactaactgctgatatcaaaggcggacagctcgccgggcttgatacttgctggatg
aaccctgacatgaagccgaatgtgccagagatcataccaacctatgagattcgtaagctt
gaagagctatatcacattttgaatatcgaaaataccgtcagctgctaa

DBGET integrated database retrieval system