KEGG   Bacillus subtilis subsp. subtilis 168: BSU07340
Entry
BSU07340          CDS       T00010                                 

Symbol
yfnA
Name
(RefSeq) amino acid permease YfnA
  KO
K03294  basic amino acid/polyamine antiporter, APA family
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    BSU07340 (yfnA)
SSDB
Motif
Pfam: AA_permease_2 AA_permease AA_permease_C Spore_permease
Other DBs
NCBI-GeneID: 936098
NCBI-ProteinID: NP_388615
Pasteur: BG12972
BSORF: BG12972
UniProt: Q797A7 A0A6M4JKZ7
Position
complement(805456..806841)
AA seq 461 aa
MSSLFRKKPLETLSAQSKSKSLARTLSAFDLTLLGIGCVIGTGIFVITGTVAATGAGPAL
IISFILAGLACALAAFCYAEFSSSIPISGSVYSYSYVTLGELLAFLIGWDLMLEYVIALS
AVATGWSSYFQSLLAGFNLHIPAALTGAPGSMAGAVFNLPAAVIILLITAIVSRGVKEST
RFNNVIVLMKIAIILLFIIVGIGYVKPDNWSPFMPFGMKGVILSAATVFFAYLGFDAVSN
ASEEVKNPQKNMPVGIISALAVCTVLYIAVSLVLTGMMPYAKLNVGDPVSFALKFVGQDA
VAGIISVGAIIGITTVMLALLYAQVRLTFAMSRDGLLPGLFAKVHPSFKTPFRNTWLTGI
VAAGIAGFINLGTLAHLVNMGTLAAFTVISIAVIVLRKKHPEIKASFRVPFVPVVPIISA
GICLWFMYSLPGVTWLSFVIWIAVGTLVYFLYSRKHSLLNK
NT seq 1386 nt   +upstreamnt  +downstreamnt
atgagttcattatttagaaaaaaaccgcttgaaacattgagtgcgcagagcaagtcaaaa
agccttgcccgtacgttaagcgcatttgatttaaccttgctcggtatcggttgtgtcatc
ggtacagggatttttgtcattacaggaacagtggcagcgaccggtgcaggtcccgccctc
atcatatcgtttattttagcggggctcgcctgtgcgctggctgctttctgttatgctgag
ttttcgtcttccattccgatttcgggaagcgtgtactcatactcatacgtgacacttgga
gagctgctcgcctttttgatcggatgggatctcatgcttgaatatgtcattgcactgtcg
gcggttgccaccggctggtcttcatactttcaatcactgcttgccggcttcaatcttcat
attccggctgcactgacaggagcgccgggaagcatggcgggcgccgtatttaaccttccg
gctgcggtgatcattctcctcatcactgcgattgtcagcagaggcgtcaaggaaagcaca
cgctttaacaacgtcatcgtactgatgaaaatcgcgatcatattattgttcattattgtc
ggcatcggctatgtgaaaccggataactggtctccttttatgccattcgggatgaaaggc
gtcatacttagcgctgccactgtattcttcgcgtaccttgggtttgacgcggtttctaac
gcatcagaggaagtgaaaaatccgcaaaaaaacatgcccgtcggcattatttcagctcta
gccgtctgtacggttctgtacatcgcggtatcgcttgtgctgacaggcatgatgccttat
gccaaattgaatgtcggagatcctgtatcctttgcgctgaaattcgtcggacaggacgct
gttgccggaattatttctgtcggtgcgattatcgggattacgacggtgatgctcgctttg
ctgtacgcacaggtccgcttgacatttgccatgagcagagacggccttctgcctggattg
ttcgcaaaggttcatccgtcatttaaaaccccgttccgcaacacatggctgacagggatc
gttgcagcgggaatcgccggctttattaacctcggaacgctggcccatctggtgaacatg
ggaacacttgccgcgtttacggtcatttccattgctgtcattgtgttaagaaagaaacat
cctgaaatcaaagcgtccttcagagtgccattcgttccggttgtgccgattatcagcgca
ggcatctgcctttggttcatgtacagccttcccggcgtcacatggctttcatttgtcatc
tggatcgctgtcggaacgctggtttacttcctatattcgagaaaacacagcttattaaac
aaataa

DBGET integrated database retrieval system