KEGG   Bacillus subtilis subsp. subtilis 168: BSU07400
Entry
BSU07400          CDS       T00010                                 

Gene name
yfmO
Definition
(RefSeq) MFS transporter
  KO
K08221  MFS transporter, ACDE family, multidrug resistance protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU07400 (yfmO)
Transporters [BR:bsu02000]
 Major facilitator superfamily (MFS)
  Drug transporters
   Putative aromatic compound/drug exporter (ACDE) family [TC:2.A.1.32]
    BSU07400 (yfmO)
SSDB
Motif
Pfam: MFS_1 MFS_3
Other DBs
NCBI-GeneID: 936111
NCBI-ProteinID: NP_388621
Pasteur: BG12966
BSORF: BG12966
UniProt: O06473 A0A6M3Z8U2
Position
812628..813818
AA seq 396 aa
MDKTTQVNQKTGLLSQPKAVWAVAFACVISFMGIGLVDPILPAIAAQLHASPSEVSLLFT
SYLLVTGFMMFFSGAISSRIGAKWTLILGLIFIIVFAGLGGSSSSIAQLVGYRGGWGLGN
ALFISTALAVIVGVSVGGSAQAIILYEAALGLGISVGPLAGGELGSISWRAPFFGVSVLM
FIALIAISFMLPKLPKPAKRVGVFDAMKALKYKGLLTMAVSAFLYNFGFFILLAYSPFVL
DLDEHGLGYVFFGWGLLLAITSVFTAPLVHKALGTVRSLVVLFIAFAAILVIMGIWTDHQ
TLIITCIVVAGAVLGMVNTIMTTAVMGSAPVERSIASSAYSSVRFIGGALAPWIAGMLSE
HFTASTPYTVGGIVVFVGMLVLLMGRKHLAGIKAGH
NT seq 1191 nt   +upstreamnt  +downstreamnt
atggataagacaacacaagtgaatcagaaaacgggtttgctcagccagccaaaagcggta
tgggctgtcgcgtttgcctgtgtgatttcttttatgggaatcgggctggtcgatccaatt
cttccggccattgccgcacaattgcatgcttcacctagtgaagtatcactcttgtttaca
agttatttgcttgtaaccggatttatgatgtttttctcaggagccatttccagccgcatc
ggcgcgaaatggacattaattctcggacttatttttattattgtgtttgcggggcttggc
ggcagctcaagctcaatcgctcagttagtcggctatcgcggcggctggggattagggaat
gctttgtttatttcaacagcgcttgcggtcatcgttggcgtgtcagtcggcggcagcgcc
caagcgattattttgtatgaggccgcgctcggtctcgggatttctgtcgggccgcttgca
ggcggagagctcggaagcatttcatggcgcgcaccgttttttggagtatctgtcctgatg
tttattgcgttaatcgcgatttctttcatgcttccgaagctgccgaaaccggcgaaacgc
gtcggtgtgtttgatgcgatgaaggcactcaaatataaaggcctgctgacaatggcggta
tcggcattcctatacaactttggattttttattttgctagcttattctccgttcgtactg
gatttagatgaacacggtcttggatatgtcttcttcggctggggccttctgctggcgatt
acgtcagtctttacggcgccgctcgtgcacaaagcgctgggcacagtgcgttcgctagtc
gttctctttatcgcctttgcggccattctcgttattatggggatctggacagaccatcag
actttgattattacatgtatcgttgtcgctggtgctgtcctcggtatggtgaatacgatc
atgacaaccgctgtgatgggttctgcgccggttgaacgttcaatcgcgtcttcagcctac
agctcagtccgcttcatcggcggcgcgctcgccccgtggattgcaggaatgctgtcagaa
cactttactgcaagcacaccatatacagtaggcggaatcgtcgtttttgtcggcatgctt
gtccttctcatgggacgtaaacatcttgctggaattaaggcggggcattaa

DBGET integrated database retrieval system