KEGG   Bacillus subtilis subsp. subtilis 168: BSU07410
Entry
BSU07410          CDS       T00010                                 

Symbol
yfmN
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Other DBs
NCBI-GeneID: 938796
NCBI-ProteinID: NP_388622
Pasteur: BG12965
BSORF: BG12965
UniProt: O06472 A0A6M4JFY7
Position
814109..814264
AA seq 51 aa
MDKAKPDEYDQKCLETLYQYIHSVMKNSFSRSSGLPLGKMRRILSCLPKES
NT seq 156 nt   +upstreamnt  +downstreamnt
atggataaggcaaaacctgacgaatatgatcagaaatgtttagaaacgctctatcaatac
atacacagcgtcatgaaaaacagcttttctcggtcgagtggtttaccgcttgggaagatg
aggaggattttgagctgtctgccaaaagagagctga

DBGET integrated database retrieval system