KEGG   Bacillus subtilis subsp. subtilis 168: BSU07440
Entry
BSU07440          CDS       T00010                                 

Symbol
yfmK
Name
(RefSeq) N-acetyltransferase YfmK
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: Acetyltransf_1 Acetyltransf_10 Acetyltransf_3 Acetyltransf_7
Other DBs
NCBI-GeneID: 936108
NCBI-ProteinID: NP_388625
Pasteur: BG12962
BSORF: BG12962
UniProt: O34536 A0A6M3Z8G3
Position
817311..817757
AA seq 148 aa
MASIDRFQVMQEPELKILEHWFENEDTRRRMDGMLLLDEWYARVNKDKHDTVIMAYDGQL
PAGMVVIEFGEERTYIGLIVNPLYRLKGYGKQILQKLMTEPDFTSVREWVACIEEDNRIS
LACFQAAGFTLEDTEPDEDGFLTLILRN
NT seq 447 nt   +upstreamnt  +downstreamnt
atggcttcaatagacaggtttcaagtaatgcaggagccagagctgaaaatccttgaacac
tggtttgagaatgaggataccagacggagaatggatgggatgctgctattagatgagtgg
tatgcacgagtaaataaagataaacacgatactgtcatcatggcgtatgatggacagctg
ccggcagggatggtcgttattgagttcggagaggagcggacatatattggattgatcgtc
aatcctttgtaccggcttaaagggtatggaaaacagatactgcaaaagctgatgaccgaa
cctgattttactagcgtgcgagaatgggtggcatgcattgaagaagacaatcgaatcagt
ttagcttgctttcaagcagcaggattcactttagaagacacggaacctgatgaagatggt
tttcttacgctgattcttcgcaactga

DBGET integrated database retrieval system