KEGG   Bacillus subtilis subsp. subtilis 168: BSU07450
Entry
BSU07450          CDS       T00010                                 

Symbol
yfmJ
Name
(RefSeq) NADP-dependent oxidoreductase YfmJ
  KO
K00359  NADPH:quinone reductase [EC:1.6.5.5]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BSU07450 (yfmJ)
Enzymes [BR:bsu01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.5  With a quinone or similar compound as acceptor
    1.6.5.5  NADPH:quinone reductase
     BSU07450 (yfmJ)
SSDB
Motif
Pfam: ADH_N_2 ADH_zinc_N ADH_zinc_N_2 ELFV_dehydrog DFP
Other DBs
NCBI-GeneID: 936106
NCBI-ProteinID: NP_388626
Pasteur: BG12961
BSORF: BG12961
UniProt: O34812 A0A6M4JJG3
Position
complement(817810..818829)
AA seq 339 aa
MTASQQQIQLARRPQGIPVHEDFRFETIPVPEPKQGEVLVKTLYVSVDPYMRGRMQDTKS
YVEPFALDKALSGGVIAEVVSDGNHLKKGDIVIGNLSWQEFSAVSESALRKIDTSLAPAS
AYLGILGMTGLTAYFGLLDIGRPKEGETVVVSGAAGAVGSTVGQIAKIKGARVVGIAGSD
EKIDYLKQELQFDEAINYKTADDIQKALQNACPDGVDVYFDNVGGPISDAVMNLLNEFAR
IPVCGAISSYNAESEADDMGPRVQSKLIKTKSLMQGFIVSDYSDRFSEGAKQLAEWLKAG
KLHYEETITEGFENIPDAFLGLFKGENKGKQLIKVSDPS
NT seq 1020 nt   +upstreamnt  +downstreamnt
atgacagcatctcagcagcaaattcaattagcaagacgtccacaaggtattcctgttcat
gaagactttcgctttgaaaccattccggttcctgaacccaagcaaggggaagtgcttgtc
aaaacgctttatgtatcggttgacccttatatgcgcggccgtatgcaggatacgaagtca
tatgttgagccgttcgccttggataaagcgctttctggaggggttatcgctgaagttgtg
tcagacgggaatcatctgaaaaaaggcgatatcgtcatcggaaatctcagctggcaggaa
ttttccgctgtgagcgagtctgccttgcgaaaaattgatacaagccttgctcccgcttcg
gcctatctcggcattttgggaatgaccggcttaacagcatacttcggattgctggacatc
ggacgcccgaaggaaggcgaaaccgtggttgtctcaggagctgccggagccgtcggttca
acagtcgggcaaattgccaaaatcaaaggcgcgcgagtcgtcggcatcgcgggctctgat
gaaaaaatcgactatttaaaacaggagcttcagtttgacgaagccatcaattacaaaaca
gcggatgatatccaaaaagcgcttcaaaacgcttgtcctgacggtgtcgatgtgtatttt
gacaatgtcggcggaccgatttcagacgcggtgatgaatctgctcaatgaatttgcccgc
attccggtgtgcggcgccatttcttcctataacgcagaaagcgaagcagatgacatgggc
cctcgtgtccaatcaaaactcattaaaacgaagtcgctgatgcaaggctttatcgtaagc
gactactccgatcgtttttctgagggagcaaaacagctggcagaatggctgaaggctggt
aaactccattacgaggaaaccatcacagaaggcttcgaaaacattcctgacgcgtttctc
ggtttatttaagggagaaaataaagggaaacagctgatcaaggtcagtgatccgagctga

DBGET integrated database retrieval system