KEGG   Bacillus subtilis subsp. subtilis 168: BSU07460
Entry
BSU07460          CDS       T00010                                 

Symbol
yfmI
Name
(RefSeq) MFS transporter
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: MFS_1 MFS_3 Sugar_tr
Other DBs
NCBI-GeneID: 936105
NCBI-ProteinID: NP_388627
Pasteur: BG12960
BSORF: BG12960
UniProt: O34440 A0A6M3ZBN7
Position
complement(819311..820531)
AA seq 406 aa
MSKGYYSILFSQTTTNLGFSLYTMVVISFLFKMTNSTTIASMVTLISIIFRIFGSAILPL
ITIRLKLPLTIIISQLIQMLLLICLFYALLRTYSNQTLILVFIIISCISFFNGWFSPLKS
AIIGEIISPDRRVKANGLLSTVDQTFQFVGWSLGGLIIAFLGEGYTIILTIFLLFTSLLS
LLFCLPHGHANSVIREKNSPNKSIVSGWRYLFSQKKLRTIIIMDLIESWAGMIWIGSVSL
AFVNEVLHKGESWWGFINGAYYLGSMIGGFIIYKLSERFQNKLINFMLIGAVSYGSLTLI
YGFISNSYLALILVLFMGPAYILRDLTQETLIQNITTEQTRINIMSARSSLVQFIFMFSI
LAIGAISDFLGVRLVYVSAGILLLVSAIYGFSQLQFKKKVNKHISF
NT seq 1221 nt   +upstreamnt  +downstreamnt
atgagtaaaggttattattctattttatttagccagaccactacaaatttaggtttttct
ctatatactatggtagtgatttcgtttttgtttaaaatgaccaattcgacaaccatcgcc
tctatggtgacattaataagtattatttttcgtatttttggaagtgctatattaccgtta
ataacaattcgattaaaactgcctcttacaataattatttctcaattgatacaaatgctg
ttattaatatgtttgttctatgctttattaagaacttactctaatcaaactctcatttta
gtctttattattattagctgtatttccttttttaatggatggttctcacctttaaaaagt
gcaattataggggaaataatctctcctgatagaagagtaaaagcaaatggattattatct
acagtggaccaaacttttcaatttgtaggctggtctttaggtggtctcataattgcattt
ttaggtgagggatataccattatacttactatctttttgttgtttacatctcttctttct
cttttattttgtctaccacatggccacgctaattctgtcatacgtgaaaaaaattctccc
aataagagtatagtaagtggttggcggtatttatttagccaaaagaaacttagaacaatt
attattatggatttaattgagtcatgggcaggaatgatttggataggatctgtctcttta
gctttcgttaacgaagtcttgcataaaggagaatcatggtggggatttattaatggagca
tattatttaggttcgatgatagggggatttataatatataagctgtcggagagatttcaa
aataagttaattaattttatgttaattggcgctgtctcatatggaagtttaactttaata
tatggttttataagtaattcatacttagctctaattttggttctctttatggggccggct
tatatattaagagatcttacacaagaaacacttattcagaacataacaaccgagcaaact
cgaattaatataatgtctgcaaggtcttctttagtacagttcatttttatgttttcaatt
ctggctataggggctatttcagatttccttggagttcgtttagtttatgtttcagcaggt
attcttttattagtgtccgcaatatatggattttctcaattacaattcaaaaaaaaggta
aataaacatataagcttttaa

DBGET integrated database retrieval system