KEGG   Bacillus subtilis subsp. subtilis 168: BSU07480
Entry
BSU07480          CDS       T00010                                 

Symbol
yfmG
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: FGE-sulfatase
Other DBs
NCBI-GeneID: 938798
NCBI-ProteinID: NP_388629
Pasteur: BG12958
BSORF: BG12958
UniProt: O34722 A0A6M3Z8R5
Position
820867..822330
AA seq 487 aa
MTLLMQDHKSIYNKDIEILIEVEELITSVPENKKNDFKSLIDNRIMTLLNKIQHPVAAEN
VFGMCIAYPNTYIRYRLIDFVEKWVPYFSAVETIINLTQDPDDLVSFKAMDVCANHKIEE
SVAYLSSIIDDVRESISYPKKPVGLGAQKVLSTLLDIFGVEKHEELVMLKNYFDQNGILP
NNFDFEEKIPQSLIEEFEKTEEDGMILIPGGFFEFGLNENEIPDKTFNWKDAVPRQKVWL
PPFFIDKYPVTNKDYDIFTEFIEENGHIFCHPNEPQNKQHRRNTYWDDRYLDNHPVTGID
FYDAFAYARYKGKELPTEFQWEKAARGEKGNVWPWGDKFDPAKVQYAGSLYNEPITSLKS
WRENLLKAHADKELNHLTSDIFEQNGESPYGVCGMIGGTWEWTRSELKTKRAFHPIFENV
PFNSVNSFAVLKGGSFFSHPGLMFPSFRAKDIPFCRHNEMGIRCVKNIPVYKIRESINGP
ITNKAIY
NT seq 1464 nt   +upstreamnt  +downstreamnt
ttgactctattaatgcaagatcataaatcaatttacaataaagatatagaaatattaatt
gaagttgaagaacttattacttctgttccagaaaataaaaaaaatgattttaagagttta
atcgataatagaattatgactctactaaataaaattcaacaccctgtagcagcggaaaat
gtgtttgggatgtgtattgcttatccgaatacttacataaggtatagattaattgatttc
gttgaaaaatgggtaccttatttctctgctgtagaaactataatcaatctaacccaggat
ccggatgatttagtttcttttaaagctatggatgtctgtgcaaatcataaaattgaagaa
tctgtagcatatttgtcttcgattattgatgatgtccgggagagtataagctaccctaaa
aaacctgtgggattaggggcccaaaaagtattaagtacattattagatatattcggtgtt
gaaaaacatgaagagctagtaatgctaaaaaattattttgatcaaaatggtatacttcct
aataactttgactttgaagaaaaaattcctcaaagtctaatagaggaattcgaaaaaaca
gaagaagatgggatgattttaattccgggtggcttttttgaattcggtttaaatgaaaat
gaaattcctgacaaaacatttaattggaaagatgctgttcctagacaaaaagtatggtta
cctccattttttatcgataagtatcctgttacaaataaagattatgatatctttaccgag
ttcatagaggaaaatgggcatatattctgtcatcctaatgaaccgcagaataaacaacat
agaagaaatacatattgggatgataggtatttagataatcatcccgttacaggtatagat
ttttatgatgcatttgcttacgcaagatataaggggaaagaattgccaaccgagtttcaa
tgggaaaaagctgctcgaggcgaaaagggtaatgtctggccttggggagataaatttgat
cctgcaaaggttcaatatgctggaagtctttataatgaacccattacttctttaaagtcc
tggagagaaaatttattaaaagctcatgctgataaagaattaaatcatttaacaagtgat
atttttgaacaaaatggtgaaagtccctatggagtatgcggtatgatcggcggaacatgg
gagtggactagaagtgagcttaaaacaaagagagctttccaccctatttttgagaatgta
ccatttaatagtgttaactcatttgccgttcttaaaggaggatcattcttctctcatcca
ggcttaatgttcccttcttttagagcaaaagatattcctttctgtcgacacaatgaaatg
gggattagatgcgtaaagaatattccagtatataaaattagagaatcaattaatgggcca
attactaataaagcaatttattaa

DBGET integrated database retrieval system