KEGG   Bacillus subtilis subsp. subtilis 168: BSU07500
Entry
BSU07500          CDS       T00010                                 

Symbol
yfmE
Name
(RefSeq) Fe(3+)-citrate import system permease protein YfmE
  KO
K23182  ferric citrate transport system permease protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    BSU07500 (yfmE)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU07500 (yfmE)
Transporters [BR:bsu02000]
 ABC transporters, prokaryotic type
  Metallic cation, iron-siderophore and vitamin B12 transporters
   Ferric citrate transporter
    BSU07500 (yfmE)
SSDB
Motif
Pfam: FecCD INV_N
Other DBs
NCBI-GeneID: 939692
NCBI-ProteinID: NP_388631
Pasteur: BG12956
BSORF: BG12956
UniProt: O34832 A0A6M3ZDN7
Position
complement(823716..824717)
AA seq 333 aa
MKKTTRKQKRPLLAILILAVILIVLSVISIGIGALYISPDAVVTNLLGLDHSFEFIIQQY
RLPRIILAILAGAGLAAAGAILQGVIRNPLASPDVVGISKGSGLAAMAVILIFPESPVYV
LPFSAFAGAAIIAVLLLMIARKKSIQPSSLALSGIALGAVCHAGMQYMMVKFPGDVNAAL
IWLTGSLWGRNWEEVKLLAPWLLILFPIVCILIPKLDLMSLGDELAQGLGENANRLRFIL
IFTAVALAGSCVAVVGSIGFIGLLAPHIARRLTGEKAKYLLPASALIGAIILLIADTLGR
GIMPPVEIPAGILTAVIGAPYFLYLLKFEARKQ
NT seq 1002 nt   +upstreamnt  +downstreamnt
atgaagaaaacaaccagaaaacaaaaacgccccttactggcgatactcatattggccgtg
attttaatcgttctgtccgtcatcagcattggaatcggtgcattatacatttcacctgat
gcggtagtgacgaatctgctgggactggatcattcctttgaatttatcatccagcaatat
cgccttccccgcattatattagcgattttggcaggtgctggacttgccgctgccggagcg
attttacagggtgtgatccgaaatccgctcgcttccccggacgttgtcggcatttcaaaa
ggctccggacttgcggcgatggctgtgattctcatctttcctgagtcgccggtatacgtg
cttccgttctccgcatttgccggagccgccattattgctgtactattattaatgatagcc
cgaaaaaagagcattcagccctcttcactggctttatcaggcattgctttaggcgcggtc
tgccacgccggaatgcaatatatgatggtcaagtttccaggcgacgtgaatgctgcactc
atttggctgacaggaagcctctggggaagaaactgggaagaagtcaagctgcttgcgcca
tggcttttgattctttttccgatcgtctgcatactcataccgaagctggatcttatgtca
ctcggggatgagcttgcacagggtctcggagaaaacgcaaaccggctgagattcatcctg
attttcaccgcggtggcgctggcgggaagctgtgtagccgtcgtcggctcaatcggtttt
atcggcttgcttgctccgcatatcgccagacggcttaccggagaaaaagctaaatattta
ctgcctgcatcggcattgattggtgctattatattattaattgcagatacgttagggcgc
ggcatcatgcctccggttgaaatacctgccggaatactgacagccgtgatcggcgcgcct
tatttcttatatttattgaaattcgaagcgaggaaacagtag

DBGET integrated database retrieval system