KEGG   Bacillus subtilis subsp. subtilis 168: BSU07520
Entry
BSU07520          CDS       T00010                                 

Symbol
yfmC
Name
(RefSeq) Fe(3+)-citrate-binding protein YfmC
  KO
K23181  ferric citrate transport system substrate-binding protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    BSU07520 (yfmC)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU07520 (yfmC)
Transporters [BR:bsu02000]
 ABC transporters, prokaryotic type
  Metallic cation, iron-siderophore and vitamin B12 transporters
   Ferric citrate transporter
    BSU07520 (yfmC)
SSDB
Motif
Pfam: Peripla_BP_2 DUF4969 FapA DUF2482
Other DBs
NCBI-GeneID: 936114
NCBI-ProteinID: NP_388633
Pasteur: BG12954
BSORF: BG12954
UniProt: O34348 A0A6M3Z8V3
Position
complement(825787..826734)
AA seq 315 aa
MRTYSNKLIAIMSVLLLACLIVSGCSSSQNNNGSGKSESKDSRVIHDEEGKTTVSGTPKR
VVVLELSFLDAVHNLGITPVGIADDNKKDMIKKLVGSSIDYTSVGTRSEPNLEVISSLKP
DLIIADAERHKNIYKQLKKIAPTIELKSREATYDETIDSFTTIAKALNKEDEGKEKLAEH
KKVINDLKAELPKDENRNIVLGVARADSFQLHTSSSYDGEIFKMLGFTHAVKSDNAYQEV
SLEQLSKIDPDILFISANEGKTIVDEWKTNPLWKNLKAVKNGQVYDADRDTWTRFRGIKS
SETSAKDVLKKVYNK
NT seq 948 nt   +upstreamnt  +downstreamnt
atgcgcacctattctaacaagttgattgccatcatgagtgttttattgctcgcctgcctc
attgtatccggctgttcatcaagccagaataacaacggaagcggcaaaagcgagtctaag
gattccagagtgatccatgacgaagaaggaaaaacgacagtaagcggcacacctaagcgg
gtggttgtgcttgagctttcattcttggatgccgttcacaatctcggcattacgccggtg
ggcatcgcagatgacaacaaaaaagatatgattaaaaagcttgtcggcagctccattgat
tacacatctgtaggcacacgcagcgaacccaatcttgaggtcatcagttccttgaagcct
gatttaatcatcgctgacgctgagcgccataaaaacatttataaacagctgaaaaaaatc
gccccgacgattgaattaaaaagccgtgaagcgacatatgacgaaacgatcgacagcttt
acgaccattgctaaagcattaaataaagaagatgaaggaaaagaaaagcttgccgagcac
aaaaaagtcatcaacgatctaaaagccgaacttccgaaagatgaaaaccgcaacatcgtt
ctcggcgttgcaagagcggattccttccagcttcatacatcatcatcctatgacggagaa
atctttaaaatgctaggctttacacacgctgtgaagtcagataacgcctatcaagaggtc
agccttgagcaattgagcaaaatcgatcctgatattttgttcatctcagccaacgaaggc
aaaaccattgtagatgagtggaaaacgaacccgctctggaaaaatctcaaagcggtgaaa
aatggacaagtctatgatgcggaccgtgacacttggacaagattcagaggcatcaagtct
agtgaaacaagcgccaaagatgtgcttaaaaaagtgtataataaatag

DBGET integrated database retrieval system