KEGG   Bacillus subtilis subsp. subtilis 168: BSU07530
Entry
BSU07530          CDS       T00010                                 

Symbol
yfmB
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: DUF3212
Other DBs
NCBI-GeneID: 938795
NCBI-ProteinID: NP_388634
Pasteur: BG12953
BSORF: BG12953
UniProt: O34626 A0A6M3Z8F2
Structure
Position
complement(826843..827211)
AA seq 122 aa
MQYFSPEQQYNAWIVSDLVKQIFHKRAGCSPGIHELAVFAEEHFHIDIDFVFSIIMNIGD
IEFALTDEIEKKLSGYLSTLLPYVTADMFETSKANAHAFLSRRHGNAAYHLFVSDDAFMR
KQ
NT seq 369 nt   +upstreamnt  +downstreamnt
atgcaatacttttcaccagaacagcaatacaatgcttggattgtgagtgatttagtcaaa
cagattttccataagcgtgccggatgttcaccaggaattcacgagcttgcggtttttgcc
gaggaacattttcatatcgatatcgactttgttttctcgattatcatgaatatcggcgac
attgaatttgcactaacagatgaaatagaaaagaaattgtccggttatctcagcactctc
cttccttatgtcactgctgatatgttcgaaacctctaaagccaacgcccatgcgtttttg
tctcgaagacacggtaacgctgcataccacttatttgtgtctgatgatgctttcatgaga
aagcagtaa

DBGET integrated database retrieval system