KEGG   Bacillus subtilis subsp. subtilis 168: BSU07540
Entry
BSU07540          CDS       T00010                                 

Symbol
yfmA
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Other DBs
NCBI-GeneID: 938800
NCBI-ProteinID: NP_388635
Pasteur: BG12952
BSORF: BG12952
Position
827252..827419
AA seq 55 aa
MVVCSVQRLLLNFDFSENRSRSYHFTMDGKQIATTIPPVFLFNVLESVSGTDDRV
NT seq 168 nt   +upstreamnt  +downstreamnt
atggtcgtgtgctccgtgcagcggcttctccttaattttgatttttctgaaaataggtcc
cgttcctatcactttaccatggacggaaaacaaatagctactaccattcctcctgttttt
ctcttcaatgttctggaatctgtttcaggtacagacgatcgggtatga

DBGET integrated database retrieval system