KEGG   Bacillus subtilis subsp. subtilis 168: BSU07550
Entry
BSU07550          CDS       T00010                                 

Symbol
yflT
Name
(RefSeq) general stress protein 17M
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: YflT Robl_LC7 ActD
Other DBs
NCBI-GeneID: 938794
NCBI-ProteinID: NP_388636
Pasteur: BG19020
BSORF: BG19020
UniProt: P80241 A0A6M4JE85
Position
827455..827802
AA seq 115 aa
MKPVVKEYTNDEQLMKDVEELQKMGVAKEDVYVLAHDDDRTERLADNTNANTIGAKETGF
KHAVGNIFNKKGDELRNKIHEIGFSEDEAAQFEKRLDEGKVLLFVTDNEKVKAWA
NT seq 348 nt   +upstreamnt  +downstreamnt
atgaaaccagttgtaaaagagtatacaaatgacgaacagctcatgaaagatgtagaggaa
ttgcagaaaatgggtgttgcgaaagaggatgtatacgtcttagctcacgacgatgacaga
acggaacgcctggctgacaacacgaacgccaacacgatcggagccaaagaaacaggtttc
aagcacgcggtgggaaatatcttcaataaaaaaggagacgagctccgcaataaaattcac
gaaatcggtttttctgaagatgaagccgctcaatttgaaaaacgcttagatgaaggaaaa
gtgcttctctttgtgacagataacgaaaaagtgaaagcttgggcataa

DBGET integrated database retrieval system