KEGG   Bacillus subtilis subsp. subtilis 168: BSU07560
Entry
BSU07560          CDS       T00010                                 

Symbol
pel
Name
(RefSeq) pectate lyase
  KO
K01728  pectate lyase [EC:4.2.2.2]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00040  Pentose and glucuronate interconversions
bsu01100  Metabolic pathways
bsu02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    BSU07560 (pel)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    BSU07560 (pel)
Enzymes [BR:bsu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.2  Acting on polysaccharides
    4.2.2.2  pectate lyase
     BSU07560 (pel)
SSDB
Motif
Pfam: Pectate_lyase_4
Other DBs
NCBI-GeneID: 936113
NCBI-ProteinID: NP_388637
Pasteur: BG10840
BSORF: BG10840
UniProt: P39116 A0A6M4JL16
Structure
Position
827993..829255
AA seq 420 aa
MKKVMLATALFLGLTPAGANAADLGHQTLGSNDGWGAYSTGTTGGSKASSSNVYTVSNRN
QLVSALGKETNTTPKIIYIKGTIDMNVDDNLKPLGLNDYKDPEYDLDKYLKAYDPSTWGK
KEPSGTQEEARARSQKNQKARVMVDIPANTTIVGSGTNAKVVGGNFQIKSDNVIIRNIEF
QDAYDYFPQWDPTDGSSGNWNSQYDNITINGGTHIWIDHCTFNDGSRPDSTSPKYYGRKY
QHHDGQTDASNGANYITMSYNYYHDHDKSSIFGSSDSKTSDDGKLKITLHHNRYKNIVQR
APRVRFGQVHVYNNYYEGSTSSSSYPFSYAWGIGKSSKIYAQNNVIDVPGLSAAKTISVF
SGGTALYDSGTLLNGTQINASAANGLSSSVGWTPSLHGSIDASANVKSNVINQAGAGKLN
NT seq 1263 nt   +upstreamnt  +downstreamnt
atgaaaaaagtgatgttagctacggctttgtttttaggattgactccagctggcgcgaac
gcagctgatttaggccaccagacgttgggatccaatgatggctggggcgcgtactcgacc
ggcacgacaggcggatcaaaagcatcctcctcaaatgtgtataccgtcagcaacagaaac
cagcttgtctcggcattagggaaggaaacgaacacaacgccaaaaatcatttatatcaag
ggaacgattgacatgaacgtggatgacaatctgaagccgcttggcctaaatgactataaa
gatccggagtatgatttggacaaatatttgaaagcctatgatcctagcacatggggcaaa
aaagagccgtcgggaacacaagaagaagcgagagcacgctctcagaaaaaccaaaaagca
cgggtcatggtggatatccctgcaaacacgacgatcgtcggttcagggactaacgctaaa
gtcgtgggaggaaacttccaaatcaagagtgataacgtcattattcgcaacattgaattc
caggatgcctatgactattttccgcaatgggatccgactgacggaagctcagggaactgg
aactcacaatacgacaacatcacgataaacggcggcacacacatctggattgatcactgt
acatttaatgacggttcgcgtccggacagcacatcaccgaaatattatggaagaaaatat
cagcaccatgacggccaaacggatgcttccaacggtgctaactatatcacgatgtcctac
aactattatcacgatcatgataaaagctccattttcggatcaagtgacagcaaaacctcc
gatgacggcaaattaaaaattacgctgcatcataaccgctataaaaatattgtccagcgc
gcgccgagagtccgcttcgggcaagtgcacgtatacaacaactattatgaaggaagcaca
agctcttcaagttatccttttagctatgcatggggaatcggaaagtcatctaaaatctat
gcccaaaacaatgtcattgacgtaccgggactgtcagctgctaaaacgatcagcgtattc
agcgggggaacggctttatatgactccggcacgttgctgaacggcacacagatcaacgca
tcggctgcaaacgggctgagctcttctgtcggctggacgccgtctctgcatggatcgatt
gatgcttctgctaatgtgaaatcaaatgttataaatcaagcgggtgcgggtaaattaaat
taa

DBGET integrated database retrieval system