KEGG   Bacillus subtilis subsp. subtilis 168: BSU07570
Entry
BSU07570          CDS       T00010                                 

Symbol
yflS
Name
(RefSeq) malate transporter YflS
  KO
K03319  divalent anion:Na+ symporter, DASS family
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    BSU07570 (yflS)
SSDB
Motif
Pfam: Na_sulph_symp CitMHS
Other DBs
NCBI-GeneID: 936122
NCBI-ProteinID: NP_388638
Pasteur: BG12951
BSORF: BG12951
UniProt: O34726
Position
829382..830818
AA seq 478 aa
MASEKDAGKQSAVKLVPLLITVAVGLIIWFIPAPSGLEPKAWHLFAIFVATIIGFISKPL
PMGAIAIFALAVTALTGTLSIEDTLSGFGNKTIWLIVIAFFISRGFIKTGLGARISYVFV
QKFGKKTLGLSYSLLFSDLILSPAIPSNTARAGGIIFPIIRSLSETFGSSPANGTERKIG
AFLLKTGFQGNLITSAMFLTAMAANPLIAKLAHDVAGVDLTWTSWAIAAIVPGLVSLIIT
PLVIYKLYPPEIKETPDAAKIATEKLKEMGPFKKSELSMVIVFLLVLVLWIFGGSFNIDA
TTTALIGLAVLLLSQVLTWDDIKKEQGAWDTLTWFAALVMLANFLNELGMVSWFSNAMKS
SVSGFSWIVAFIILIVVYYYSHYFFASATAHISAMYSAFLAVVVAAGAPPLLAALSLAFI
SNLFGSTTHYGSGAAPVFFGAGYIPQGKWWSIGFILSIVHIIVWLVIGGLWWKVLGIW
NT seq 1437 nt   +upstreamnt  +downstreamnt
atggcttcagaaaaagacgcaggaaaacagtcagcagtaaagcttgttccattgcttatt
actgtcgctgtgggactaatcatctggtttattcccgctccgtccggacttgaacctaaa
gcttggcatttgtttgcgatttttgtcgcaacaattatcggctttatctccaagcccttg
ccaatgggtgcaattgcaatttttgcattggcggttactgcactaactggaacactatca
attgaggatacattaagcggattcgggaataagaccatttggcttatcgttatcgcattc
tttatttcccggggatttatcaaaaccggtctcggtgcgagaatttcgtatgtattcgtt
cagaaattcggaaaaaaaacccttggactttcttattcactgctattcagtgatttaata
ctttcacctgctattccaagtaatacggcgcgtgcaggaggcattatatttcctattatc
agatcattatccgaaacattcggatcaagcccggcaaatggaacagagagaaaaatcggt
gcattcttattaaaaaccggttttcaggggaatctgatcacatctgctatgttcctgaca
gcgatggcggcgaacccgctgattgccaagctggcccatgatgtcgcaggggtggactta
acatggacaagctgggcaattgccgcgattgtaccgggacttgtaagcttaatcatcacg
ccgcttgtgatttacaaactgtatccgccggaaatcaaagaaacaccggatgcggcgaaa
atcgcaacagaaaaactgaaagaaatgggaccgttcaaaaaatcggagctttccatggtt
atcgtgtttcttttggtgcttgtgctgtggatttttggcggcagcttcaacatcgacgct
accacaaccgcattgatcggtttggccgttctcttattatcacaagttctgacttgggat
gatatcaagaaagaacagggcgcttgggatacgctcacttggtttgcggcgcttgtcatg
ctcgccaacttcttgaatgaattaggcatggtgtcttggttcagtaatgccatgaaatca
tccgtatcagggttctcttggattgtggcattcatcattttaattgttgtgtattattac
tctcactatttctttgcaagtgcgacagcccacatcagtgcgatgtattcagcatttttg
gctgtcgtcgtggcagcgggcgcaccgccgcttttagcagcgctgagcctcgcgttcatc
agcaacctgttcgggtcaacgactcactacggttctggagcggctccggtcttcttcgga
gcaggctacatcccgcaaggcaaatggtggtccatcggatttatcctgtcgattgttcat
atcatcgtatggcttgtgatcggcggattatggtggaaagtactaggaatatggtag

DBGET integrated database retrieval system