KEGG   Bacillus subtilis subsp. subtilis 168: BSU07580
Entry
BSU07580          CDS       T00010                                 

Symbol
citS
Name
(RefSeq) sensor protein CitS
  KO
K11637  two-component system, CitB family, sensor histidine kinase CitS [EC:2.7.13.3]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BSU07580 (citS)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:bsu01001]
    BSU07580 (citS)
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:bsu02022]
    BSU07580 (citS)
Enzymes [BR:bsu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     BSU07580 (citS)
Protein kinases [BR:bsu01001]
 Histidine kinases
  CitB family [OT]
   BSU07580 (citS)
Two-component system [BR:bsu02022]
 CitB family
  CitS-CitT (magnesium-citrate transport)
   BSU07580 (citS)
SSDB
Motif
Pfam: HATPase_c HATPase_c_5 SPOB_a sCache_3_2 DUF4064 E1-E2_ATPase DUF1892 HATPase_c_3 CTD9 PAS HATPase_c_2 Internalin_N sCache_like
Other DBs
NCBI-GeneID: 939687
NCBI-ProteinID: NP_388639
Pasteur: BG12576
BSORF: BG12576
UniProt: O34427 A0A6M3Z8H2
Position
830945..832573
AA seq 542 aa
MVKKRFHFSLQTKIMGLIAALLVFVIGVLTITLAVQHTQGERRQAEQLAVQTARTISYMP
PVKELIERKDGHAAQTQEVIEQMKEQTGAFAIYVLNEKGDIRSASGKSGLKKLERSREIL
FGGSHVSETKADGRRVIRGSAPIIKEQKGYSQVIGSVSVDFLQTETEQSIKKHLRNLSVI
AVLVLLLGFIGAAVLAKSIRKDTLGLEPHEIAALYRERNAMLFAIREGIIATNREGVVTM
MNVSAAEMLKLPEPVIHLPIDDVMPGAGLMSVLEKGEMLPNQEVSVNDQVFIINTKVMNQ
GGQAYGIVVSFREKTELKKLIDTLTEVRKYSEDLRAQTHEFSNKLYAILGLLELGEYDEA
IDLIKEEYAIQNEQHDLLFHNIHSQQVQAILLGKISKASEKKVKLVIDENSSLAPLPAHI
GLSHLITIIGNLIDNAFEAVAEQSVKEVLFFITDMGHDIVIEVSDTGPGVPPEKIEAVFE
RGYSSKGMRRGYGLANVKDSVRELGGWIELANQKTGGAVFTVFIPKEKQRGNPFDSHRDC
GG
NT seq 1629 nt   +upstreamnt  +downstreamnt
gtggtgaaaaagcggttccatttttccctgcaaacaaaaataatggggctgattgcggct
ctgctggtctttgtcattggtgtgctgaccattacgttagccgttcagcatacacaggga
gaacggagacaggcagagcagctggcggttcaaacggcgagaaccatttcctatatgccg
ccggttaaagagctcattgagagaaaagacggacatgcggctcagacgcaagaggtcatt
gaacaaatgaaagaacagactggtgcgtttgccatttatgttttgaacgaaaaaggagac
attcgcagcgcctctggaaaaagcggattaaagaaactggagcgcagcagagaaattttg
tttggcggttcgcatgtttctgaaacaaaagcggatggacgaagagtgatcagagggagc
gcgccgattataaaagaacagaagggatacagccaagtgatcggcagcgtgtctgttgat
tttctgcaaacggagacagagcaaagcatcaaaaagcatttgagaaatttgagtgtgatt
gctgtgcttgtactgctgctcggatttattggcgccgccgtgctggcgaaaagcatcaga
aaggatacgctcgggcttgaaccgcatgagatcgcggctctatatcgtgagaggaacgca
atgcttttcgcgattcgagaagggattattgccaccaatcgtgaaggcgtcgtcaccatg
atgaacgtatcggcggccgagatgctgaagctgcccgagcctgtgatccatcttcctata
gatgacgtcatgccgggagcagggctgatgtctgtgcttgaaaaaggagaaatgctgccg
aaccaggaagtaagcgtcaacgatcaagtgtttattatcaatacgaaagtgatgaatcaa
ggcgggcaggcgtatgggattgtcgtcagcttcagggagaaaacagagctgaagaagctg
atcgacacattgacagaggttcgcaaatattcagaggatctcagggcgcagactcatgaa
ttttcaaataagctttatgcgattttagggctgcttgagcttggggagtatgatgaagcc
attgatctgattaaagaggaatatgcgatacaaaatgaacagcatgatcttttattccat
aacatccattcgcagcaggtgcaggccattttgttagggaaaataagcaaggcatcggaa
aagaaggtcaagctggtgattgatgagaacagctcactcgcgcctcttcctgcgcatatc
ggcttgtcccatcttattacgattattggcaatttaattgataacgctttcgaagctgta
gcggagcaaagcgtgaaggaagttttgttttttatcacggatatgggccatgacattgtc
attgaagtatcagacacagggcccggtgtgccgccagagaaaatagaagctgtgtttgag
agaggctattcttcaaaggggatgaggagaggctacggtctggccaatgtgaaagactca
gtgcgtgaactgggcggctggatcgaactggcgaatcaaaaaactggcggggcggtattc
actgtatttataccgaaggagaaacaaagggggaatccatttgattcacatcgcgattgc
ggaggatga

DBGET integrated database retrieval system