KEGG   Bacillus subtilis subsp. subtilis 168: BSU07610
Entry
BSU07610          CDS       T00010                                 

Symbol
citM
Name
(RefSeq) Mg(2+)/citrate complex secondary transporter
  KO
K11639  Mg2+/citrate complex secondary transporter
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BSU07610 (citM)
SSDB
Motif
Pfam: CitMHS Na_H_antiporter Na_H_antiport_2 DUF4229
Other DBs
NCBI-GeneID: 938801
NCBI-ProteinID: NP_388642
Pasteur: BG11832
BSORF: BG11832
UniProt: P55069 A0A6M3Z8S1
Position
834383..835684
AA seq 433 aa
MLAILGFLMMLVFMALIMTKRLSVLTALVLTPIVFALIAGFGFTEVGDMMISGIQQVAPT
AVMIMFAILYFGIMIDTGLFDPMVGKILSMVKGDPLKIVVGTAVLTMLVALDGDGSTTYM
ITTSAMLPLYLLLGIRPIILAGIAGVGMGIMNTIPWGGATPRAASALGVDPAELTGPMIP
VIASGMLCMVAVAYVLGKAERKRLGVIELKQPANANEPAAAVEDEWKRPKLWWFNLLLTL
SLIGCLVSGKVSLTVLFVIAFCIALIVNYPNLEHQRQRIAAHSSNVLAIGSMIFAAGVFT
GILTGTKMVDEMAISLVSMIPEQMGGLIPAIVALTSGIFTFLMPNDAYFYGVLPILSETA
VAYGVDKVEIARASIIGQPIHMLSPLVPSTHLLVGLVGVSIDDHQKFALKWAVLAVIVMT
AIALLIGAISISV
NT seq 1302 nt   +upstreamnt  +downstreamnt
gtgttagcaatcttaggctttctcatgatgcttgtgtttatggcattgatcatgacaaaa
cggctttctgttttaacagcattagttttgacgccgattgtgtttgcgcttatcgccgga
tttggatttactgaagttggggacatgatgatttcggggattcagcaagtcgcgccgact
gcggtcatgattatgtttgcgatcttatattttggaattatgattgatacaggcctgttt
gatccaatggttggcaaaattttaagcatggtcaaaggagaccctttaaaaattgttgtc
gggacagcggttcttacaatgctcgtcgccttggacggagatggctcgacaacgtacatg
attacgacaagcgccatgcttccgctctatttgctgctaggcatccggccaattatcttg
gcaggaatcgcgggagtcggcatgggaatcatgaacacgattccatggggaggtgcgacg
ccgagggcggcgagtgcgctgggggttgatccagctgagcttacagggccgatgattcct
gtcattgcaagcgggatgctttgtatggtggcagttgcgtatgtgcttggaaaagcggaa
cgaaagcgccttggtgtgattgaactgaaacagccagccaatgccaatgaaccggctgct
gcggttgaagatgagtggaagcggccgaagctttggtggttcaatttattgttaacgctt
tctttaataggatgtttagtatcgggtaaagtcagtttaaccgtactgtttgtcattgcg
ttttgtattgcgctgattgtgaattatcccaatctcgagcatcagagacagcgcatcgcg
gcgcattccagcaacgtgctggctatcggttcaatgatttttgctgcgggggtgttcacg
gggattttgacaggcacgaaaatggttgatgaaatggcgatctcgctcgtgtccatgata
ccggaacaaatgggcggattgatcccggcgattgttgccttaacaagcggcattttcaca
tttttgatgccgaatgacgcgtatttctacggggtgctgccgattttatcagaaacagct
gtcgcatacggtgtggataaagtggaaattgccagagcctctattatcggccagccgatt
catatgctgagtccgcttgtgccatccactcatttgcttgtcggactcgtcggagtttct
attgatgaccatcaaaaattcgcattgaaatgggcggttctcgcagtgatcgtcatgacg
gctatcgctctattgatcggtgcgatctctatttccgtatga

DBGET integrated database retrieval system