KEGG   Bacillus subtilis subsp. subtilis 168: BSU07620
Entry
BSU07620          CDS       T00010                                 

Symbol
yflN
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: Lactamase_B Lactamase_B_2 ODP Fucokinase
Other DBs
NCBI-GeneID: 936120
NCBI-ProteinID: NP_388643
Pasteur: BG12949
BSORF: BG12949
UniProt: O34409 A0A6M3ZDP7
Position
835740..836534
AA seq 264 aa
MSDPYMPLTSVRSGAGFEAAKGVHGLTVQIANVYFIQLPSEPHSFVLIDAGMPQSAGVIV
NEAKQRFGEGFQLKAIILTHGHFDHIGAIEEILEHWDVPVYIHSREMPYVTGKEDYPPAR
PDSKSGLVAKLSPLFPRHSIDISSHVQALPEDGSVPFLDEWMWIATPGHTPGHISLFRDD
GRVLVAGDAVITVEQEKMADVLIQKQELHGPPAYFTPDTETAAESILKLAGLEPEALLTG
HGIPMTGKNFRSDLTELANRLSSI
NT seq 795 nt   +upstreamnt  +downstreamnt
atgagtgatccttatatgccgctgacttcagtcagaagcggagcggggttcgaagcggca
aaaggggtgcacggcctgactgtgcaaattgcgaatgtctattttattcagctgccttct
gaacctcactcatttgttttaattgatgccggcatgccccaatcagccggcgtgattgtc
aatgaagccaaacaaagattcggtgaagggtttcagctgaaggcgattatcctcacacac
gggcactttgaccatattggggcaatcgaagagatccttgagcattgggatgtgcctgtt
tatatccattctcgggaaatgccttatgtaacaggtaaagaggattatcctccggctcgt
cctgacagcaagagcgggctggtcgctaagctgtcgccgctgtttccgcggcactctatc
gatatttcctcacatgtccaggcactgccggaagacggttcagttccttttcttgacgag
tggatgtggatcgcgacaccaggacacacgccgggccatatttcgttattccgcgatgac
ggccgcgtgcttgtggcaggtgatgctgttattacagtggaacaggagaaaatggctgac
gtcttgatacaaaaacaggagcttcacgggccgccggcttatttcacgcctgacacagag
acggccgctgagtccattctaaagctggccggtcttgaaccggaagcgttattgaccggg
cacggcataccgatgaccggcaaaaactttcgaagtgacttaactgaattggcaaatcgg
ttatcgtctatttga

DBGET integrated database retrieval system