KEGG   Bacillus subtilis subsp. subtilis 168: BSU07630
Entry
BSU07630          CDS       T00010                                 

Symbol
nosA
Name
(RefSeq) nitric oxide synthase oxygenase
  KO
K00491  nitric-oxide synthase, bacterial [EC:1.14.14.47]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00220  Arginine biosynthesis
bsu00330  Arginine and proline metabolism
bsu01100  Metabolic pathways
bsu01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    BSU07630 (nosA)
   00330 Arginine and proline metabolism
    BSU07630 (nosA)
Enzymes [BR:bsu01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.47  nitric-oxide synthase (flavodoxin)
     BSU07630 (nosA)
SSDB
Motif
Pfam: NO_synthase DUF4434
Other DBs
NCBI-GeneID: 938802
NCBI-ProteinID: NP_388644
Pasteur: BG12948
BSORF: BG12948
UniProt: O34453 A0A6M4JG05
Structure
Position
836653..837744
AA seq 363 aa
MEEKEILWNEAKAFIAACYQELGKEEEVKDRLADIKSEIDLTGSYVHTKEELEHGAKMAW
RNSNRCIGRLFWNSLNVIDRRDVRTKEEVRDALFHHIETATNNGKIRPTITIFPPEEKGE
KQVEIWNHQLIRYAGYESDGERIGDPASCSLTAACEELGWRGERTDFDLLPLIFRMKGDE
QPVWYELPRSLVIEVPITHPDIEAFSDLELKWYGVPIISDMKLEVGGIHYNAAPFNGWYM
GTEIGARNLADEKRYDKLKKVASVIGIAADYNTDLWKDQALVELNKAVLHSYKKQGVSIV
DHHTAASQFKRFEEQEEEAGRKLTGDWTWLIPPISPAATHIFHRSYDNSIVKPNYFYQDK
PYE
NT seq 1092 nt   +upstreamnt  +downstreamnt
ttggaagaaaaagaaatactctggaacgaagcgaaagcgtttattgccgcatgctatcag
gaattgggaaaggaggaggaagtgaaagaccgtctcgcggacattaaaagtgaaattgac
ctgaccggaagctatgtacatacgaaggaagagctggagcacggagcgaaaatggcttgg
agaaacagcaaccgctgcatcggcagattgttctggaattcgctgaatgttatcgacaga
cgagacgtccggacgaaggaggaagtgcgtgatgccctctttcaccatattgaaaccgcc
accaataacgggaaaatcagaccgaccattacgattttccctccggaagagaagggtgaa
aagcaagtcgagatctggaatcatcagctgatccggtacgctggatatgagtcagacgga
gaaagaatcggcgacccggcttcctgttccctgacagcagcctgcgaagagctcggctgg
cgcggagagcgaacggattttgacctgctgccgctcatttttcgcatgaaaggggacgag
cagcctgtctggtatgagctgccgcgttcacttgtgattgaggttccaatcacacatccg
gacatcgaggcgttttctgatttggagctgaagtggtacggcgtgcctattatttctgat
atgaagcttgaggtcgggggcattcattataatgccgcgccatttaacggctggtatatg
ggcacggagatcggagcgagaaacctcgcagatgaaaagcggtacgacaagctcaaaaaa
gtagcgtccgtgatcggcatcgccgctgattacaatacggatttatggaaggatcaagcg
ctagttgaattgaataaagctgtgctgcactcgtataaaaagcagggtgtcagcatcgtt
gaccatcatacagcggcaagccagtttaaacggtttgaagaacaggaggaagaagcgggc
agaaagctgacgggggactggacgtggctgattccgccaatttcacccgctgccactcat
atcttccaccgctcctatgataactcaatcgttaagccgaactatttttatcaagataag
ccttatgagtaa

DBGET integrated database retrieval system