KEGG   Bacillus subtilis subsp. subtilis 168: BSU07640
Entry
BSU07640          CDS       T00010                                 

Symbol
yflL
Name
(RefSeq) acylphosphatase
  KO
K01512  acylphosphatase [EC:3.6.1.7]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00620  Pyruvate metabolism
bsu00627  Aminobenzoate degradation
bsu01100  Metabolic pathways
bsu01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BSU07640 (yflL)
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    BSU07640 (yflL)
Enzymes [BR:bsu01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.7  acylphosphatase
     BSU07640 (yflL)
SSDB
Motif
Pfam: Acylphosphatase
Other DBs
NCBI-GeneID: 939684
NCBI-ProteinID: NP_388645
Pasteur: BG12947
BSORF: BG12947
UniProt: O35031 A0A6M3Z8W2
Structure
PDB: 
3BR8 2HLT 2HLU 2FHM

Position
complement(837735..838010)
AA seq 91 aa
MLQYRIIVDGRVQGVGFRYFVQMEADKRKLAGWVKNRDDGRVEILAEGPENALQSFVEAV
KNGSPFSKVTDISVTESRSLEGHHRFSIVYS
NT seq 276 nt   +upstreamnt  +downstreamnt
atgcttcaataccgaatcattgtagacggccgggttcaaggtgtgggctttcgctatttt
gttcaaatggaagctgataagcgaaaactggccggctgggtcaaaaaccgtgatgacggg
cgtgtcgagattttggcagagggtccggaaaacgccctgcaatcgtttgttgaggctgta
aagaacggaagccctttctcaaaggttaccgacatctctgtgactgaatcccgcagcctt
gaaggccatcatcgattttctattgtttactcataa

DBGET integrated database retrieval system