KEGG   Bacillus subtilis subsp. subtilis 168: BSU07650
Entry
BSU07650          CDS       T00010                                 

Symbol
yflK
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: MOSC 3-alpha
Other DBs
NCBI-GeneID: 936119
NCBI-ProteinID: NP_388646
Pasteur: BG12946
BSORF: BG12946
UniProt: O34542 A0A6M3Z8H1
Position
838077..838742
AA seq 221 aa
MKQERYSVLSLNLGKPQTLEYDGKKIETGIMKRPAKSAVMLYRENFEGDGQADLVNHGGP
DKAVCVYPAEHYPFWEEFLSRPLSNAAFGENLTVAGLTEENVCIGDVFRLDEAVVQVSQP
RQPCVKLAKKFGVKEMVLKVQQTGYTGFYFRVLEEGRVSPGANLELLSRGEKGISVQFAN
RINYHDAKNLTAIERILSEAALSESWRASFMKKKDRLLPVE
NT seq 666 nt   +upstreamnt  +downstreamnt
atgaaacaagagcgctattcagttctttctcttaatctgggaaaaccgcagacgcttgaa
tatgacggaaagaaaatcgaaaccggcatcatgaagcggccggctaaatcagccgtcatg
ctgtatcgggagaattttgaaggagacggacaggcggacctcgtcaaccacggcggacct
gataaggctgtctgtgtctacccggcggagcattatccgttttgggaagagttcctctca
agaccgctgtcaaatgccgcatttggagaaaatctgacggtcgcgggcctgactgaggag
aatgtttgcatcggggatgtgttcagacttgatgaagctgttgttcaggtcagccagccg
cgccagccgtgtgtaaagctggcgaaaaagtttggtgtaaaagaaatggtgctgaaggtc
cagcaaaccggctatacagggttttattttcgcgtgctggaggagggcagggtgtctccc
ggcgcgaaccttgaattgctgtccagaggagagaaaggcatatccgtccagttcgcgaac
cgcatcaactaccatgatgcaaaaaatctcaccgccattgaacggattttaagtgaggct
gcactatcggaaagctggagagcgtcctttatgaaaaaaaaggacaggctgctgccggtt
gaatag

DBGET integrated database retrieval system