KEGG   Bacillus subtilis subsp. subtilis 168: BSU07660
Entry
BSU07660          CDS       T00010                                 

Symbol
yflJ
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: DUF2639
Other DBs
NCBI-GeneID: 939685
NCBI-ProteinID: NP_388647
Pasteur: BG12945
BSORF: BG12945
UniProt: O34345 A0A6M4JL26
Position
complement(838783..838920)
AA seq 45 aa
MHYGSKGWYVAELKKQGITHHEGRKLQSYKTYFLANLLESKKKQS
NT seq 138 nt   +upstreamnt  +downstreamnt
atgcattacggcagtaaaggctggtatgtggcagaactaaaaaagcaggggatcacgcac
catgaaggaagaaagcttcaaagctataaaacctattttcttgccaacctgcttgaatca
aagaaaaaacaatcttaa

DBGET integrated database retrieval system