KEGG   Bacillus subtilis subsp. subtilis 168: BSU07670
Entry
BSU07670          CDS       T00010                                 

Symbol
yflI
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: DUF2107 DUF6463 Tudor_RapA DUF565 DUF3185 Vut_1 DUF3040
Other DBs
NCBI-GeneID: 936118
NCBI-ProteinID: NP_388648
Pasteur: BG12944
BSORF: BG12944
UniProt: O34905 A0A6M3Z8G8
Position
complement(839077..839232)
AA seq 51 aa
MWFIIFGIIFFIEGIIMTVYGVKKKNGMLTYIGIVFAIMTFGVVMIKLTGH
NT seq 156 nt   +upstreamnt  +downstreamnt
atgtggtttattattttcggcatcatttttttcattgaaggcatcattatgaccgtttac
ggcgttaagaaaaaaaacgggatgctcacatatatcggcattgttttcgccattatgaca
tttggcgttgtcatgatcaaactaaccggccattaa

DBGET integrated database retrieval system