KEGG   Bacillus subtilis subsp. subtilis 168: BSU07680
Entry
BSU07680          CDS       T00010                                 

Symbol
yflH
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: DUF3243 YueH
Other DBs
NCBI-GeneID: 936129
NCBI-ProteinID: NP_388649
Pasteur: BG12943
BSORF: BG12943
UniProt: O34306 A0A6M4JDX5
Structure
Position
complement(839339..839653)
AA seq 104 aa
MNRDQEKIQIENEMNAMHGTIKEDILKDFEEFKGYLKKQVNRGKKLGLDDGKLVKSAAIL
GDYLAKHEEPQNGEEMLLQELWSVADEDEKEHLAQLLVKLVDKQ
NT seq 315 nt   +upstreamnt  +downstreamnt
atgaacagagatcaagaaaaaatccaaattgaaaacgaaatgaacgcgatgcatggcaca
ataaaagaagacattttaaaagactttgaggaatttaaaggctacctgaaaaaacaagtc
aaccgaggcaaaaagctgggattggatgacggcaagcttgtaaaaagcgctgcgatcctg
ggagactacctcgcaaagcatgaagagccgcaaaacggtgaagaaatgctgctgcaagag
ctttggagcgttgcagacgaagatgagaaagaacatttggcacagcttctggtcaaattg
gttgataaacaataa

DBGET integrated database retrieval system