KEGG   Bacillus subtilis subsp. subtilis 168: BSU07700
Entry
BSU07700          CDS       T00010                                 

Symbol
nagP
Name
(RefSeq) PTS system-N-acetylglucosamine-specific transporter subunit EIICB
  KO
K02804  N-acetylglucosamine PTS system EIICBA or EIICB component [EC:2.7.1.193]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00520  Amino sugar and nucleotide sugar metabolism
bsu02060  Phosphotransferase system (PTS)
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    BSU07700 (nagP)
 09130 Environmental Information Processing
  09131 Membrane transport
   02060 Phosphotransferase system (PTS)
    BSU07700 (nagP)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU07700 (nagP)
Enzymes [BR:bsu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.193  protein-Npi-phosphohistidine---N-acetyl-D-glucosamine phosphotransferase
     BSU07700 (nagP)
Transporters [BR:bsu02000]
 Phosphotransferase system (PTS)
  Enzyme II [TC:4.A]
   N-Acetylglucosamine-specific II component
    BSU07700 (nagP)
SSDB
Motif
Pfam: PTS_EIIC PTS_EIIB
Other DBs
NCBI-GeneID: 938807
NCBI-ProteinID: NP_388651
Pasteur: BG12941
BSORF: BG12941
UniProt: O34521 A0A6M4JFX9
Position
840656..842014
AA seq 452 aa
MLSFLQKLGKSFMLPIAVLPAVGIILALGREDVFNIPFVYQAGTAVFDHLPLIFAIGIAI
GISKDSNGAAGLSGAISYLMLDAATKTIDKTNNMAVFGGIIAGLIAGYTYNRFKDTKLPE
YLGFFSGRRLVPILTAIITIILAGIFGVVWPPIQSCINSFGEWMLGLGGIGAGIFGLFNR
LLIPLGLHHVLNNIFWFQFGEYNGVTGDLARFFAKDPTAGTYMTGFFPIMMFGLPAACLA
MVVTAKPSKRKATAGMMIGFALTAFITGITEPIEFAFMFLSPLLYAVHAVLTGLSLFIVN
WLGIRSGFSFSAGAIDYVLSYGIAEKPLLLLLVGICYAAVYFIVFYVLIKALNLKTPGRE
DDDVDEVLDENTVQDVNENIMLKGLGGKENLQTIDHCATRLRLTVKDTALVDEALLKKAG
AKGVVKSGGQSVQVIIGPNVEFAAEELRAAVK
NT seq 1359 nt   +upstreamnt  +downstreamnt
atgctttcatttttacaaaaactcgggaagtcatttatgctcccgattgcggttctgcct
gcggttggaattatccttgcgcttggcagagaggatgtatttaatatcccgtttgtctat
caggcggggacggcggtttttgatcatctgccgcttatttttgcgatcggtattgccatc
ggcatttcaaaagacagcaatggggcagcgggtttatcaggggcgatatcgtatctgatg
cttgacgcggcaacaaagacaattgataaaacaaataacatggcggtgtttgggggaatt
attgccggtttaattgccggttacacctataaccgcttcaaggataccaagctgcctgaa
tatctcgggttcttcagtggcagacggcttgtgccgattttaacagccattattacgatc
attttagcgggcatattcggagtggtctggccgccgattcaatcgtgtatcaactcgttt
ggagagtggatgctcgggctcggcggcatcggggcaggcatattcggcctattcaacagg
ctgttaattccgcttggccttcaccatgtgctgaacaatattttctggttccaattcgga
gaatataacggagtgacaggggatttggcgcgctttttcgcgaaagatccgactgcgggc
acatatatgaccggatttttcccaatcatgatgttcggtcttccggcggcgtgtctggct
atggttgtgactgcgaagccgtctaaacggaaagcgacggctggaatgatgattggattt
gctttaacggcgtttatcacagggattacggagccgattgagtttgcatttatgttttta
tctccgcttttatacgctgttcacgcggtcttaaccgggttatctttatttatcgtcaac
tggctcggcatccgctcaggcttctctttttcagccggagctatcgattatgtgctcagc
tatggaatcgcggaaaaaccgctgcttctgcttttggtaggtatatgctatgcggcagta
tactttatcgtgttttatgtactgattaaggctttgaatttaaaaacgcctggacgggaa
gacgatgatgtggatgaagtgctggatgaaaatactgttcaggatgtaaatgaaaacatc
atgctgaaagggctcggcggaaaagaaaaccttcaaaccattgatcattgcgccacaagg
ctgcgactgactgtgaaggataccgctttggtggatgaagcactgctaaagaaagcaggc
gcaaaaggggttgtcaaatcgggcgggcaatcggttcaagtcattattggcccgaatgtg
gaatttgcagctgaggaattgagggctgctgtcaaataa

DBGET integrated database retrieval system