KEGG   Bacillus subtilis subsp. subtilis 168: BSU07710
Entry
BSU07710          CDS       T00010                                 

Symbol
yflE
Name
(RefSeq) lipoteichoic acid synthase
  KO
K19005  lipoteichoic acid synthase [EC:2.7.8.20]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00561  Glycerolipid metabolism
bsu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    BSU07710 (yflE)
Enzymes [BR:bsu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.8  Transferases for other substituted phosphate groups
    2.7.8.20  phosphatidylglycerol---membrane-oligosaccharide glycerophosphotransferase
     BSU07710 (yflE)
SSDB
Motif
Pfam: Sulfatase DUF229 Phosphodiest DUF1501
Other DBs
NCBI-GeneID: 939200
NCBI-ProteinID: NP_388652
Pasteur: BG12940
BSORF: BG12940
UniProt: O34952 A0A6M3Z8T2
Structure
Position
complement(842047..843996)
AA seq 649 aa
MKTFIKERGLAFFLIAVVLLWIKTYVGYVLNFNLGIDNTIQKILLFVNPLSSSLFFLGFG
LLFKKKLQQTAIIVIHFLMSFLLYANIVYYRFFNDFITIPVIMQAKTNGGQLGDSAFSLM
RPTDAFYFIDTIILIILAIKVNKPAETSSKKSFRIIFASSILVFLINLAVAESDRPELLT
RSFDRNYLVKYLGTYNFTIYDAVQNIKSNSQRALADSSDVTEVENYMKANYDVPNNVYFG
KAEGKNVIYVSLESLQSFIIDYKIDGKEVTPFLNKLAHDNETFYFDNFFHQTGQGKTSDA
EFMMENSLYPLAQGSVFVNKAQNTLQSVPAILKSKNYTSATFHGNTQTFWNRNEMYKAEG
IDKFFDSAYYDMNEENTKNYGMKDKPFFKESMPLLESLPQPFYTKFITLSNHFPFGMDEG
DTDFPAGDFGDSVVDNYFQSAHYLDQSIEQFFNDLKKDGLYDKSIIVMYGDHYGISENHN
KAMAKVLGKDEITDYDNAQLQRVPLFIHAAGVKGEKVHKYAGDVDVAPTILHLLGVDTKD
YLMSGSDILSKEHREVIPFRNGDFISPKYTKISGKYYDTKTGKELDESEVDKSEDSLVKK
ELEMSDKIINGDLLRFYEPKGFKKVNPSDYDYTKHDEDSSETSKDNEDK
NT seq 1950 nt   +upstreamnt  +downstreamnt
atgaaaacatttataaaagaaagaggactggccttcttcttaattgcggtcgtcctgtta
tggatcaaaacgtatgtcggttatgtcctgaatttcaacttaggaatagacaacacgata
caaaaaatattgctttttgtgaatcctcttagctcaagcttgttctttcttggctttgga
ctcttgttcaagaaaaaattacagcagacagccattatagtgattcattttttaatgtct
tttttactgtacgccaacattgtgtactacagatttttcaatgattttattacaattccg
gtcattatgcaggctaaaacaaacggcggccaactcggtgacagcgcattttcgctgatg
agaccgactgacgccttttactttatcgatacgatcatcctgatcatcttggcgatcaaa
gtaaacaagcctgccgaaacgtcaagcaaaaaatcgttccgaattatttttgcgtcttca
attcttgtgttcttgatcaacctggcagttgcggaatcagaccgtcctgaattgctgaca
agatcattcgaccggaactatcttgtgaaatacttgggaacatacaatttcacgatttat
gacgctgtacagaatatcaagtccaacagccagcgcgcgcttgccgattccagcgacgta
acggaagtagaaaactacatgaaagccaattacgatgtgccgaataacgtgtatttcggc
aaagcggaaggaaaaaacgtcatttacgtttcacttgaatctttgcagtcatttatcatc
gactataaaattgacggcaaagaagtgacaccattcttaaataaactggcacatgataac
gaaacgttctactttgataactttttccaccaaacgggacaaggtaaaacatctgatgct
gaatttatgatggaaaactctctgtacccgctggctcaaggttcagttttcgtaaacaaa
gcgcaaaacacgctgcaatccgttccggcgattctgaagtctaagaattacacatctgct
actttccacgggaacacgcagacgttctggaaccgtaacgaaatgtacaaggcggaaggc
attgataaattctttgattctgcttactatgacatgaacgaagaaaacacgaaaaactac
ggcatgaaagacaaaccgttcttcaaagaatcaatgccgctgctggaaagcctgccgcag
ccgttctatacgaagttcattaccctttccaaccacttcccattcggaatggatgagggg
gatacagacttcccggctggagactttggtgactctgtcgtcgataactatttccagtca
gcccattaccttgatcagtccattgaacaattcttcaatgatctgaaaaaagacgggtta
tatgataaatcgattattgtgatgtacggagaccactacggcatctctgaaaaccacaat
aaagcgatggcgaaagtgcttggcaaggatgaaatcactgattacgacaacgcccagctt
caacgggtgccgctctttatccacgctgccggcgtgaagggcgagaaagttcataaatat
gccggagacgttgatgtggctcctaccattctgcatctgctcggagtggatacgaaggac
tatctgatgtccggttctgatattttatcgaaagaacaccgtgaagtgattccgttccga
aacggagactttatttcaccgaagtacacgaaaatatccggtaagtattacgacacgaaa
accggaaaagaactcgatgaatccgaagtcgacaagtcagaagactcactcgtcaagaag
gaacttgaaatgtccgataaaatcataaacggagacctgctgcggttctacgagccgaaa
ggttttaagaaggtgaatccttctgattatgattacacaaaacatgacgaagattcttcc
gaaacgtcaaaggataacgaagataaataa

DBGET integrated database retrieval system